BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30419 (496 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0027 + 16593133-16593573 79 3e-15 02_01_0563 + 4134954-4135388 79 3e-15 07_03_1250 - 25183375-25183815 78 3e-15 11_03_0135 - 10547460-10547558,10547926-10548086,10548183-105483... 28 4.7 09_04_0302 + 16501020-16501049,16501568-16501659,16502063-165021... 27 6.3 08_02_1146 + 24678142-24678258,24678550-24678587,24678997-246790... 27 6.3 02_02_0525 - 11182043-11182080,11182386-11182511,11182760-11183486 27 6.3 07_03_1737 + 29137654-29137842,29137999-29138061,29138196-291382... 27 8.3 04_03_1020 - 21761297-21761555,21761630-21761739,21762402-217626... 27 8.3 03_05_0070 - 20478396-20478505,20478605-20478780,20481162-204812... 27 8.3 01_06_1427 + 37296883-37297588,37298504-37298658,37300596-37300955 27 8.3 >03_04_0027 + 16593133-16593573 Length = 146 Score = 78.6 bits (185), Expect = 3e-15 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +2 Query: 113 NAGGEHHHRINMDKYHPGYFGKLGMRNFHFRKNKNFCPVLNLDKLWT 253 NAGG HHHRI DKYHPGYFGK+GMR FH N+ CP +N+++LW+ Sbjct: 34 NAGGMHHHRILFDKYHPGYFGKVGMRYFHKLSNRFHCPAVNVERLWS 80 >02_01_0563 + 4134954-4135388 Length = 144 Score = 78.6 bits (185), Expect = 3e-15 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +2 Query: 113 NAGGEHHHRINMDKYHPGYFGKLGMRNFHFRKNKNFCPVLNLDKLWT 253 NAGG HHHRI DKYHPGYFGK+GMR FH N+ CP +N+++LW+ Sbjct: 34 NAGGMHHHRILFDKYHPGYFGKVGMRYFHRLSNRFHCPAVNVERLWS 80 >07_03_1250 - 25183375-25183815 Length = 146 Score = 78.2 bits (184), Expect = 3e-15 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = +2 Query: 113 NAGGEHHHRINMDKYHPGYFGKLGMRNFHFRKNKNFCPVLNLDKLWT 253 NAGG HHHRI DKYHPGYFGK+GMR FH +NK + P +N+++LW+ Sbjct: 34 NAGGMHHHRILFDKYHPGYFGKVGMRYFHRLRNKFYSPAVNVERLWS 80 >11_03_0135 - 10547460-10547558,10547926-10548086,10548183-10548306, 10548566-10548729,10549803-10549883,10549973-10550097, 10550200-10550430,10550566-10550588,10551055-10551539, 10551678-10552075,10552903-10552988,10553120-10553397, 10553494-10553714,10553927-10554018,10554148-10554213, 10555855-10556022 Length = 933 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 270 EAEVCICSRWQ-GPRHQYCQSWILQVARQRQTPQTTCHSK 386 E ++ +CSR G H YC ++Q + + TCHS+ Sbjct: 288 EEKLAVCSRCNDGAEHIYCMRVMMQEVPKAKWLCETCHSE 327 >09_04_0302 + 16501020-16501049,16501568-16501659,16502063-16502198, 16502297-16502727,16502950-16503028 Length = 255 Score = 27.5 bits (58), Expect = 6.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 140 FCDGAHHQHYHDLLDAYG 87 +C+G HH H H D+ G Sbjct: 132 YCNGGHHHHGHQCYDSVG 149 >08_02_1146 + 24678142-24678258,24678550-24678587,24678997-24679012, 24679874-24680002,24680073-24680229,24680337-24680530, 24680668-24680916,24681196-24681309,24681949-24681990, 24682402-24682572,24682932-24683104,24683378-24683624, 24684046-24684130,24684401-24684510,24684714-24684977, 24685885-24685950,24686431-24686525,24686780-24686858 Length = 781 Score = 27.5 bits (58), Expect = 6.3 Identities = 9/27 (33%), Positives = 12/27 (44%) Frame = +3 Query: 303 GPRHQYCQSWILQVARQRQTPQTTCHS 383 GP H WI + +Q P+ HS Sbjct: 258 GPMHNAADKWITEFGKQNNNPEEWAHS 284 >02_02_0525 - 11182043-11182080,11182386-11182511,11182760-11183486 Length = 296 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -2 Query: 123 PPALPRPPGCLRCFPIRPCP 64 PPA P PP L C P+ P P Sbjct: 10 PPAPPSPPPALPCDPMPPPP 29 >07_03_1737 + 29137654-29137842,29137999-29138061,29138196-29138267, 29138411-29138518,29138615-29138695,29138818-29138871, 29138956-29139081,29139162-29139251,29139444-29139566, 29139667-29139777,29139927-29140040,29140214-29140270, 29140350-29140424,29140526-29140600 Length = 445 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -3 Query: 134 DGAHHQHYHDLLDAYGAFRYXHVRD*QTSQLPSLL 30 D ++ ++HD+ DA+G HV++ Q P+L+ Sbjct: 284 DDKYYPYFHDVYDAFGDSEEKHVKEAMEEQ-PTLM 317 >04_03_1020 - 21761297-21761555,21761630-21761739,21762402-21762635, 21762710-21762817,21762910-21762969,21763549-21763624, 21763710-21763870,21764485-21764547,21764657-21764744, 21765062-21765592,21766344-21766783 Length = 709 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -2 Query: 126 SPP-ALPRPPGCLRCFPIRPCP 64 SPP LP PPG C P+ P P Sbjct: 263 SPPHPLPLPPGPATCSPLPPSP 284 >03_05_0070 - 20478396-20478505,20478605-20478780,20481162-20481265, 20481346-20481504,20481718-20481857,20482222-20482311, 20482902-20482970,20484295-20484516,20486175-20486293, 20486377-20486492,20488058-20488146,20488790-20488883 Length = 495 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = +3 Query: 312 HQYCQSWILQVARQRQTPQTTCHSKSKVLLKISREENQGCGWC 440 H Y S ILQ QR + + V + I N+G WC Sbjct: 437 HTYLDSAILQHQLQRLSEHNLLKATPSVFVVIQAIVNEGAVWC 479 >01_06_1427 + 37296883-37297588,37298504-37298658,37300596-37300955 Length = 406 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 314 MTGTLPSGADAYFSLVCSETMSKAYLSSKL 225 MTG LP A Y LVC T + +L S L Sbjct: 346 MTGLLPQEAMQYLDLVCRCTKNTRHLVSML 375 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,916,992 Number of Sequences: 37544 Number of extensions: 236979 Number of successful extensions: 729 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1035514020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -