BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30417 (804 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ396550-1|ABD60145.1| 113|Anopheles gambiae adipokinetic hormo... 24 4.8 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 24 4.8 >DQ396550-1|ABD60145.1| 113|Anopheles gambiae adipokinetic hormone II protein. Length = 113 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 296 SSIPTTAYQGSWIVSIMILCSALTPIPSA 382 +SI ++ + + + ++ LC+ L P+PSA Sbjct: 2 NSISSSRHLAAKLFLLVALCAVLLPVPSA 30 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/48 (22%), Positives = 21/48 (43%) Frame = +2 Query: 200 IWNSIMCDPHYCNSRYLLRWPSPTLLYLESEESSIPTTAYQGSWIVSI 343 +W + + + Y +R+ S L+Y E +P YQ S + + Sbjct: 108 VWKPDIVLFNNADGNYEVRYKSNVLIYPNGEVLWVPPAIYQSSCTIDV 155 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 765,224 Number of Sequences: 2352 Number of extensions: 14796 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -