BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30412 (815 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37452| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 1.5 SB_32794| Best HMM Match : Gam (HMM E-Value=5.8) 30 2.6 SB_21193| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_18608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_39193| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.029) 28 7.9 >SB_37452| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 211 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 290 RIHRGPSR-KVDEFATCRSNAGFIVVYYLEHCGRFP 186 R+H+G R + + C S AG++ V+Y H G P Sbjct: 24 RLHKGEKRYQCQQCGKCFSKAGYLTVHYRYHTGERP 59 >SB_32794| Best HMM Match : Gam (HMM E-Value=5.8) Length = 511 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 503 QSDSLQCPNGNLLLTPLD*HLIFQPWSRVK 414 +SDSL+CP+ N L+ D +F W+ +K Sbjct: 470 ESDSLECPSHNELIHNEDKEEVFDEWNLIK 499 >SB_21193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 503 QSDSLQCPNGNLLLTPLD*HLIFQPWSRVK 414 +SDSL+CP+ N L+ D +F W+ +K Sbjct: 280 ESDSLECPSHNELIHNEDKEEVFDEWNLIK 309 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 90 NKIFSDFQKNLDQEQELRETIRTICKEVDQISRE 191 N + N ++ Q+LRE ICKE +Q+ RE Sbjct: 1299 NTSLEEKDNNEEEVQQLREWYDVICKEKEQLERE 1332 >SB_18608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 29.1 bits (62), Expect = 4.5 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 588 QVRDGTERRLQAIELEERSFAQTFRRPKVRREENRGSRLRSQHQGAAAQGRCG 746 +VR+G E L +E R+ + R+P+ E RG R H+G R G Sbjct: 277 EVREGAEVAL-LLETLRRAALEHGRKPRTEGRERRGREERIYHEGRREGKRLG 328 >SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1501 Score = 28.7 bits (61), Expect = 6.0 Identities = 21/64 (32%), Positives = 33/64 (51%) Frame = +3 Query: 510 DDVLRIVSSGRELGDPRRLRAPPEDLQVRDGTERRLQAIELEERSFAQTFRRPKVRREEN 689 +D+ R S D R+R +D + R+ ERRL+ E E+R + R K R +++ Sbjct: 1130 EDLRRRSDSWHRRDDEERMRREEKDARRREEEERRLR--EEEDRLRREDELRRK-REDDD 1186 Query: 690 RGSR 701 RG R Sbjct: 1187 RGRR 1190 >SB_39193| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.029) Length = 1769 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/48 (22%), Positives = 27/48 (56%) Frame = +3 Query: 54 IKHVKMCDNELINKIFSDFQKNLDQEQELRETIRTICKEVDQISREAT 197 I ++ D+E++ + D +K LD+ E+R + I +++++ + T Sbjct: 1279 IATLRALDDEILKLLVEDLEKFLDEVDEMRGKLHKIVFKIEELLSQKT 1326 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,730,745 Number of Sequences: 59808 Number of extensions: 482401 Number of successful extensions: 1474 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1474 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2275631710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -