BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30412 (815 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 25 2.8 AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-tran... 24 4.9 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 6.4 AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-li... 24 6.4 AF203337-1|AAF19832.1| 184|Anopheles gambiae immune-responsive ... 24 6.4 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 25.0 bits (52), Expect = 2.8 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 606 ERRLQAIELEERSFAQTFRRPKVRREENRGSRLR 707 +RR Q + + Q RR ++R E+ R +RLR Sbjct: 95 QRRQQQQHQQRSNATQAQRREQLRNEQRRPARLR 128 >AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-transferase D5 protein. Length = 216 Score = 24.2 bits (50), Expect = 4.9 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 407 ILASHETMAEILGVSPVELKEGFHLDIEDY 496 + A H T+A+I + + E F D+E Y Sbjct: 146 VAADHLTLADIFMLGSITALEWFRYDLERY 175 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.8 bits (49), Expect = 6.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 242 GMWQTRLLFEKAHDGYARLKDAVPP 316 G TRL + + D Y ++K A PP Sbjct: 259 GCLSTRLFYYQLTDLYKKIKKACPP 283 >AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-like protein protein. Length = 219 Score = 23.8 bits (49), Expect = 6.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 51 LIKHVKMCDNELINKIFSDFQKNLDQEQELRETIRTIC 164 ++ H + L N + F LD+ +L ET+ TIC Sbjct: 41 IVSHAEFYKGGLFNDVALLF---LDKPADLMETVNTIC 75 >AF203337-1|AAF19832.1| 184|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR9 protein. Length = 184 Score = 23.8 bits (49), Expect = 6.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 51 LIKHVKMCDNELINKIFSDFQKNLDQEQELRETIRTIC 164 ++ H + L N + F LD+ +L ET+ TIC Sbjct: 149 IVSHAEFYKGGLFNDVALLF---LDKPADLMETVNTIC 183 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 799,676 Number of Sequences: 2352 Number of extensions: 16054 Number of successful extensions: 39 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86487024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -