BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30411 (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 8.3 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 8.3 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/33 (27%), Positives = 14/33 (42%) Frame = -2 Query: 576 EWLRSPIDFSNARGRAKPLPTMPLEYISNIPFN 478 EW DF + R + + +Y N PF+ Sbjct: 40 EWKYIDYDFGSDEKRQAAIQSGEYDYTKNYPFD 72 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 530 PSRCLPCHLNTFQIFHSTDTYFEP 459 PS C+ C +QI+ + +++ P Sbjct: 191 PSHCVVCQNFFYQIYATLGSFYIP 214 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,503 Number of Sequences: 438 Number of extensions: 4188 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -