BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30410 (670 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 23 3.0 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 23 3.0 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 23 3.0 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 9.1 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 22.6 bits (46), Expect = 3.0 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -2 Query: 249 YIVSLVGLHLTHHCFFLFCKRKSPIFRYPFENTIFIIISCKYII 118 Y+V+ V + L + F KS ++P +T+ IIIS +I Sbjct: 95 YVVTTVLVVLVGYERFDILLNKSKNLQFPLLSTLIIIISLGCLI 138 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 22.6 bits (46), Expect = 3.0 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -2 Query: 249 YIVSLVGLHLTHHCFFLFCKRKSPIFRYPFENTIFIIISCKYII 118 Y+V+ V + L + F KS ++P +T+ IIIS +I Sbjct: 95 YVVTTVLVVLVGYERFDILLNKSKNLQFPLLSTLIIIISLGCLI 138 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 22.6 bits (46), Expect = 3.0 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -2 Query: 249 YIVSLVGLHLTHHCFFLFCKRKSPIFRYPFENTIFIIISCKYII 118 Y+V+ V + L + F KS ++P +T+ IIIS +I Sbjct: 95 YVVTTVLVVLVGYERFDILLNKSKNLQFPLLSTLIIIISLGCLI 138 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 365 FLTGLMKLCVTKIIK 409 F +G KLC KI+K Sbjct: 360 FRSGFFKLCGMKIVK 374 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,115 Number of Sequences: 336 Number of extensions: 3065 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -