BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30406 (676 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 4.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 4.0 AF321227-6|AAK16426.1| 150|Tribolium castaneum Pb protein. 22 5.3 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 22 5.3 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 21 9.2 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 4.0 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 208 LNNF*LKSCLSRPEFKSNMAAAVVSGKDIEKPQAE 312 LNN K S +F +N A +V+ EKP+++ Sbjct: 412 LNNLLDKKPYSTYKFPTNFDALIVNEMRSEKPESK 446 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.2 bits (45), Expect = 4.0 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 208 LNNF*LKSCLSRPEFKSNMAAAVVSGKDIEKPQAE 312 LNN K S +F +N A +V+ EKP+++ Sbjct: 304 LNNLLDKKPYSTYKFPTNFDALIVNEMRSEKPESK 338 >AF321227-6|AAK16426.1| 150|Tribolium castaneum Pb protein. Length = 150 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 Query: 415 LRVKGPVRMPT 447 +RVK P+RMPT Sbjct: 1 MRVKHPLRMPT 11 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 Query: 415 LRVKGPVRMPT 447 +RVK P+RMPT Sbjct: 1 MRVKHPLRMPT 11 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 21.0 bits (42), Expect = 9.2 Identities = 5/20 (25%), Positives = 15/20 (75%) Frame = +1 Query: 286 KDIEKPQAEVSPIHRIRITL 345 +++EK + ++S +H+ +T+ Sbjct: 92 REVEKAKRDLSSVHKTTLTI 111 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,660 Number of Sequences: 336 Number of extensions: 2979 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -