BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30402 (684 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-l... 48 4e-06 At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-l... 48 4e-06 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 47 1e-05 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 46 2e-05 At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing ... 37 0.014 At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing ... 37 0.014 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 35 0.044 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 35 0.044 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 34 0.076 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 34 0.076 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 34 0.10 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 34 0.10 At5g58130.1 68418.m07273 RNA recognition motif (RRM)-containing ... 33 0.13 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 33 0.13 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 33 0.13 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 33 0.13 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 33 0.13 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 33 0.18 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 33 0.18 At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing ... 33 0.18 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 33 0.18 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 33 0.23 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 33 0.23 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 33 0.23 At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing ... 33 0.23 At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing ... 33 0.23 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 33 0.23 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 33 0.23 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 33 0.23 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 33 0.23 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 32 0.31 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 32 0.31 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 32 0.31 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 32 0.41 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 32 0.41 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 31 0.54 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 31 0.54 At2g37340.2 68415.m04579 splicing factor RSZ33 (RSZ33) nearly id... 31 0.54 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 31 0.54 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 31 0.54 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 31 0.54 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 31 0.71 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 31 0.71 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 31 0.94 At1g67550.1 68414.m07696 urease, putative / urea amidohydrolase,... 31 0.94 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 30 1.2 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 30 1.6 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 30 1.6 At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing ... 29 2.2 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 29 2.2 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 29 2.2 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 29 2.2 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 29 2.9 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 29 2.9 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 29 2.9 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 29 2.9 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 29 2.9 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 29 2.9 At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein... 29 2.9 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 29 2.9 At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly id... 29 2.9 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 29 2.9 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 29 2.9 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 29 2.9 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 29 2.9 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 29 2.9 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 29 3.8 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 29 3.8 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 29 3.8 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 29 3.8 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 29 3.8 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 29 3.8 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 28 5.0 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 28 5.0 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 28 5.0 At1g05510.1 68414.m00563 expressed protein 28 5.0 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 28 6.6 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 28 6.6 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 28 6.6 At5g47330.1 68418.m05834 palmitoyl protein thioesterase family p... 28 6.6 At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein ... 28 6.6 At5g44770.1 68418.m05487 DC1 domain-containing protein contains ... 27 8.8 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 27 8.8 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 27 8.8 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 27 8.8 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 27 8.8 At1g60490.1 68414.m06810 phosphatidylinositol 3-kinase (PI3K) id... 27 8.8 >At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 48.4 bits (110), Expect = 4e-06 Identities = 21/40 (52%), Positives = 27/40 (67%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGFA 253 TRVYVG L + + +LE EF +G L +VWVA PPG+A Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYA 41 >At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 48.4 bits (110), Expect = 4e-06 Identities = 21/40 (52%), Positives = 27/40 (67%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGFA 253 TRVYVG L + + +LE EF +G L +VWVA PPG+A Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYA 41 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/40 (50%), Positives = 27/40 (67%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGFA 253 +RVYVG L + + +LE EF +G + SVWVA PPG+A Sbjct: 2 SRVYVGNLDPRVTERELEDEFRSFGVIRSVWVARRPPGYA 41 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/40 (50%), Positives = 27/40 (67%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGFA 253 +RVYVG L + + +LE EF +G + SVWVA PPG+A Sbjct: 2 SRVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPGYA 41 >At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing protein Length = 830 Score = 36.7 bits (81), Expect = 0.014 Identities = 18/41 (43%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = +1 Query: 232 TKSPRF-RFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 T + RF RFIE+ ++++AE A A+N +E+ G +K+E+SR Sbjct: 302 TPNRRFHRFIEYYDVRDAETALKALNRSEIGGKCIKLELSR 342 >At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing protein Length = 843 Score = 36.7 bits (81), Expect = 0.014 Identities = 18/41 (43%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = +1 Query: 232 TKSPRF-RFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 T + RF RFIE+ ++++AE A A+N +E+ G +K+E+SR Sbjct: 315 TPNRRFHRFIEYYDVRDAETALKALNRSEIGGKCIKLELSR 355 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 35.1 bits (77), Expect = 0.044 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +2 Query: 128 GGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 223 G TR+YVG L + DLER F +YG++ V Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDV 40 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 + F+EF + ++A+DA ++G + G+ + VE SR Sbjct: 46 YAFVEFSDPRDADDARYYLDGRDFDGSRITVEASR 80 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 35.1 bits (77), Expect = 0.044 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +2 Query: 128 GGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 223 G TR+YVG L + DLER F +YG++ V Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDV 40 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 + F+EF + ++A+DA ++G + G+ + VE SR Sbjct: 46 YAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSR 80 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 34.3 bits (75), Expect = 0.076 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 348 + P + F+EFE+ ++AEDA +G + G L+VE++ Sbjct: 43 RPPCYCFVEFEHSRDAEDAIKGRDGYNLDGCRLRVELA 80 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 140 VYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 241 +YVG L I++ ++E F KYG++ + + + P Sbjct: 9 IYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPP 42 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 34.3 bits (75), Expect = 0.076 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +1 Query: 211 TKLSLGSTKSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 T + T S +IE+ N +EA A A+N TE+ G L VEI++ Sbjct: 376 TVVDCSITDSKHIAYIEYSNSEEAT-AALALNNTEVFGRALNVEIAK 421 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 33.9 bits (74), Expect = 0.10 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +2 Query: 140 VYVGGLVEGIKKEDLEREFDKYGKL 214 ++VGG+ + K+DLE EF K+GK+ Sbjct: 252 LWVGGIGPNVSKDDLEEEFSKFGKI 276 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 348 + P + F+EFE+ ++A+DA +G + G L+VEI+ Sbjct: 43 RPPGYAFVEFEDPRDADDAIYGRDGYDFDGCRLRVEIA 80 Score = 30.7 bits (66), Expect = 0.94 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +2 Query: 119 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSVWVAL--NPPGFA 253 MSS R +YVG L I+K ++E F KYG + + + + PPG+A Sbjct: 1 MSSRWNRTIYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRPPGYA 48 >At5g58130.1 68418.m07273 RNA recognition motif (RRM)-containing protein Length = 748 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 122 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 223 S GG R++VGGL E + ++DL + F G +++V Sbjct: 6 SGGGVRLHVGGLGESVGRDDLLKIFSPMGTVDAV 39 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVE 342 + IE+E +EA+ A SAMNG E+L + V+ Sbjct: 138 YALIEYEKKEEAQSAISAMNGAELLTQNVSVD 169 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 33.5 bits (73), Expect = 0.13 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 348 + P + F+EF++ ++AEDA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELA 80 Score = 32.7 bits (71), Expect = 0.23 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +2 Query: 119 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSV--WVALNPPGFA 253 MSS +R VYVG L I++ ++E F KYG + + V PPG+A Sbjct: 1 MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYA 48 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 33.5 bits (73), Expect = 0.13 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 348 + P + F+EF++ ++AEDA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELA 80 Score = 32.7 bits (71), Expect = 0.23 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +2 Query: 119 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSV--WVALNPPGFA 253 MSS +R VYVG L I++ ++E F KYG + + V PPG+A Sbjct: 1 MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYA 48 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 33.5 bits (73), Expect = 0.13 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 348 + P + F+EF++ ++AEDA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELA 80 Score = 32.7 bits (71), Expect = 0.23 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +2 Query: 119 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSV--WVALNPPGFA 253 MSS +R VYVG L I++ ++E F KYG + + V PPG+A Sbjct: 1 MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYA 48 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 131 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 241 GT +YV GL + +DLE F K GK+ S ++ + P Sbjct: 71 GTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEP 107 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 131 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 241 GT +YV GL + +DLE F K GK+ S ++ + P Sbjct: 70 GTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEP 106 >At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, gb:D86122 Length = 785 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = +1 Query: 250 RFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 +F+EF +++ A+ A A+N TE+ G +K+E SR Sbjct: 261 KFVEFFDVRSADAALKALNRTEIAGKRIKLEHSR 294 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 125 SGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGFA 253 S G +Y+ L + + E L+ F +YG + S V LNP G + Sbjct: 329 SQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQGMS 371 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 247 T VYV L + I +++L + F K+G ++S V + G Sbjct: 229 TNVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQSG 266 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 32.7 bits (71), Expect = 0.23 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 131 GTRVYVGGLVEGIKKEDLEREFDKYGKL 214 G+R++VGGL + DLER F ++G + Sbjct: 6 GSRIFVGGLSPEVTDRDLERAFSRFGDI 33 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 32.7 bits (71), Expect = 0.23 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = +2 Query: 119 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSVWVAL--NPPGFA 253 MSS +R +YVG L I++ ++E F KYG + + + + PPG+A Sbjct: 1 MSSRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYA 48 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 348 + P + F+EFE+ ++A+DA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELA 80 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 32.7 bits (71), Expect = 0.23 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = +2 Query: 119 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSVWVAL--NPPGFA 253 MSS +R +YVG L I++ ++E F KYG + + + + PPG+A Sbjct: 1 MSSRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYA 48 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 348 + P + F+EFE+ ++A+DA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELA 80 >At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 32.7 bits (71), Expect = 0.23 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 250 RFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 +F+EF +++ AE A A+N E+ G +KVE SR Sbjct: 292 KFVEFYDVRGAEAALKALNRCEIAGKRIKVEPSR 325 >At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 32.7 bits (71), Expect = 0.23 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 250 RFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 +F+EF +++ AE A A+N E+ G +KVE SR Sbjct: 292 KFVEFYDVRGAEAALKALNRCEIAGKRIKVEPSR 325 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 32.7 bits (71), Expect = 0.23 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 131 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 241 G +YV GL + + DLE F K GK+ V + L+P Sbjct: 44 GNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDP 80 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 32.7 bits (71), Expect = 0.23 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 131 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 241 G +YV GL + + DLE F K GK+ V + L+P Sbjct: 74 GNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDP 110 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 F FI +++ A++A + MNG ++ G LKV++ R Sbjct: 382 FGFISYDSQAAAQNAINTMNGCQLSGKKLKVQLKR 416 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 F FI +++ A++A + MNG ++ G LKV++ R Sbjct: 373 FGFISYDSQAAAQNAINTMNGCQLSGKKLKVQLKR 407 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 348 +S F FI FE+ + + A + MNG E+ G L++ ++ Sbjct: 258 RSRGFGFISFESAENVQSALATMNGVEVEGRALRLNLA 295 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 32.3 bits (70), Expect = 0.31 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKL 214 +R++VGGL + + LE FD+YGK+ Sbjct: 12 SRIFVGGLSWDVTERQLESTFDRYGKI 38 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 32.3 bits (70), Expect = 0.31 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKL 214 +R++VGGL + + LE FD+YGK+ Sbjct: 12 SRIFVGGLSWDVTERQLESTFDRYGKI 38 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 31.9 bits (69), Expect = 0.41 Identities = 12/30 (40%), Positives = 22/30 (73%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 223 T ++VGGL + EDL++ F+++G++ SV Sbjct: 304 TTIFVGGLDSSVTDEDLKQPFNEFGEIVSV 333 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 31.9 bits (69), Expect = 0.41 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKL 214 T+V+VGGL + E L R FD+YG + Sbjct: 24 TKVFVGGLAWETQSETLRRHFDQYGDI 50 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 31.5 bits (68), Expect = 0.54 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 247 T VYV L E +DL+ F +YGK+ S V + G Sbjct: 29 TNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEG 66 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 226 GSTKSPRFRFIEFENLQEAEDACSAMNG 309 G KS F F+ FEN +A A ++NG Sbjct: 64 GEGKSKGFGFVNFENADDAARAVESLNG 91 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 31.5 bits (68), Expect = 0.54 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +1 Query: 250 RFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 RF+EF ++++A A MNG E+ G + +E SR Sbjct: 252 RFVEFYDVRDAARAFDRMNGKEIGGKQVVIEFSR 285 >At2g37340.2 68415.m04579 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 260 Score = 31.5 bits (68), Expect = 0.54 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = +1 Query: 202 IWKTKLSLGSTKSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 +W+ + S S FR EF + ++A+DA ++G + G+ + VE SR Sbjct: 1 MWENTPCMWSLLSSHFRNQEFGDPRDADDARHYLDGRDFDGSRITVEFSR 50 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 31.5 bits (68), Expect = 0.54 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 348 +S + F+ F +EAE+A + +NG E++G + ++ S Sbjct: 234 RSSGYGFVSFATREEAENAITKLNGKEIMGRPITLKFS 271 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 31.5 bits (68), Expect = 0.54 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 122 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 247 S G R+YVG L + ++DL + F+ +G + V V + G Sbjct: 281 SGGARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRDETG 322 Score = 31.5 bits (68), Expect = 0.54 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 173 KEDLEREFDKYGKLNSVWVALNPPGF 250 KED++ E K+GKLN ++V N GF Sbjct: 488 KEDVKEECSKFGKLNHIFVDKNSVGF 513 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 31.5 bits (68), Expect = 0.54 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 223 T ++VGGL + EDL++ F ++G++ SV Sbjct: 306 TTIFVGGLDSSVTDEDLKQPFSEFGEIVSV 335 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 31.1 bits (67), Expect = 0.71 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEI 345 KS F FI+FE+ + AE A AMN ++ LKV + Sbjct: 99 KSKHFGFIQFEDPEVAEIAAGAMNDYLLMEHMLKVHV 135 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 31.1 bits (67), Expect = 0.71 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 140 VYVGGLVEGIKKEDLEREFDKYGKLNSV 223 V+VG ++ DLER FDKYG+++ V Sbjct: 4 VFVGNFEYETRQSDLERLFDKYGRVDRV 31 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 30.7 bits (66), Expect = 0.94 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEISRK 354 KS +F FI F + QEA+ A N T + + + VEI+ K Sbjct: 7 KSRQFGFIGFRSAQEAQQAIKYFNNTYLGTSLIIVEIAHK 46 >At1g67550.1 68414.m07696 urease, putative / urea amidohydrolase, putative similar to SP|P07374 Urease (EC 3.5.1.5) (Urea amidohydrolase) {Canavalia ensiformis}; contains Pfam profile PF01979: Amidohydrolase family Length = 838 Score = 30.7 bits (66), Expect = 0.94 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +2 Query: 356 GTGPAEVGSEVGAAVTSGVVV--HSEVREEAGLTTHTVAAAAGRTIVT 493 GT PA + + + A + V H++ E+G HT+ A GRTI T Sbjct: 494 GTTPAAIDNCLAVAEEYDIQVNIHTDTLNESGFVEHTINAFRGRTIHT 541 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 140 VYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 241 ++VG L +G +EDL++ F G++ V + NP Sbjct: 216 IFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNP 249 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 F F+ +++ A++A MNG + G LKV++ R Sbjct: 392 FGFVSYDSQAAAQNAIDMMNGRHLGGKKLKVQLKR 426 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 226 GSTKSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVE 342 G+ KS F F+ +E+ + A +NG +LG T+KV+ Sbjct: 72 GTGKSKGFAFLAYEDQRSTILAVDNLNGALVLGRTIKVD 110 >At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing protein RNA-binding protein LAH1, Saccharomyces cerevisiae, PIR2:B48600; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 433 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +2 Query: 167 IKKEDLEREFDKYGKLNSV 223 +K+ED+E F +YGK+NSV Sbjct: 127 VKREDVESFFSQYGKVNSV 145 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +2 Query: 137 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 241 +VYVG L + + KE LE F + GK+ S V+ P Sbjct: 178 KVYVGNLAKTVTKEMLENLFSEKGKVVSAKVSRVP 212 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKL 214 T+V+VGGL + E L + F++YG++ Sbjct: 24 TKVFVGGLAWETQSETLRQHFEQYGEI 50 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 247 T VYV L + I ++L++ F KYG ++S V + G Sbjct: 225 TNVYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQSG 262 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +1 Query: 232 TKSPR-FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISRK 354 T+ P+ F FI FE+ +A+ A A+NG + G + VE +++ Sbjct: 103 TQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETAKE 144 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 137 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWV 229 +++VGGL I +E+ + FD++G + V V Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVV 141 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 137 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWV 229 +++VGGL I +E+ + FD++G + V V Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVV 141 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 137 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWV 229 +++VGGL I +E+ + FD++G + V V Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVV 141 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 140 VYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 241 V+VG L +KK+ + +EF K+G++ SV + P Sbjct: 173 VFVGNLPLKVKKKVILKEFSKFGEVESVRIRSVP 206 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +2 Query: 116 TMSSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 223 TM G + VYVGGL I +E + R F YG + +V Sbjct: 2 TMDDGNS-VYVGGLPYDITEEAVRRVFSIYGSVLTV 36 >At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 243 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 + F+EF + ++A+DA ++G + G+ + VE SR Sbjct: 5 YAFVEFSDPRDADDARYYLDGRDFDGSRITVEASR 39 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 226 GSTKSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 348 GS +S F F++F +A A AM+G +LG L++ + Sbjct: 77 GSGRSRGFGFVDFAEEGDALSAKDAMDGKGLLGRPLRISFA 117 >At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 249 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +1 Query: 247 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 + F+EF + ++A+DA ++G + G+ + VE SR Sbjct: 5 YAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSR 39 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 250 RFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 351 RF+EF ++++A A MNG + G + ++ SR Sbjct: 222 RFVEFFDVRDAAKALRVMNGKVISGKPMVIQFSR 255 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEISRK 354 +S F F+ N+++ ++GTE LG LKV + K Sbjct: 124 QSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFADK 163 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 226 GSTKSPRFRFIEFENLQEAEDACSAMNG 309 G KS F F+ FEN +A A A+NG Sbjct: 259 GEGKSKGFGFVNFENSDDAARAVDALNG 286 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 125 SGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 247 S G+ +YV L E + + L F +G + S V +P G Sbjct: 324 SQGSNLYVKNLDESVTDDKLREHFAPFGTITSCKVMRDPSG 364 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 125 SGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 223 S + ++VGGL + +EDL + F +G++ SV Sbjct: 324 SNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSV 356 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 247 T VYV LVE DL+R F ++G++ S V + G Sbjct: 119 TNVYVKNLVETATDADLKRLFGEFGEITSAVVMKDGEG 156 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 119 MSSGGTRVYVGGLVEGIKKEDLEREFDKYG 208 MS R +VGGL EDL+R F ++G Sbjct: 1 MSEVEYRCFVGGLAWATNDEDLQRTFSQFG 30 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 119 MSSGGTRVYVGGLVEGIKKEDLEREFDKYG 208 MS R +VGGL EDL+R F ++G Sbjct: 1 MSEVEYRCFVGGLAWATNDEDLQRTFSQFG 30 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 119 MSSGGTRVYVGGLVEGIKKEDLEREFDKYG 208 MS R +VGGL EDL+R F ++G Sbjct: 1 MSEVEYRCFVGGLAWATNDEDLQRTFSQFG 30 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 119 MSSGGTRVYVGGLVEGIKKEDLEREFDKYG 208 MS R +VGGL EDL+R F ++G Sbjct: 1 MSEVEYRCFVGGLAWATNDEDLQRTFSQFG 30 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 235 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEI 345 +S F F+ + + EAE A S M+G E+ G + V++ Sbjct: 42 RSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVKL 78 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 226 GSTKSPRFRFIEFENLQEAEDACSAMNG 309 G KS F F+ FEN ++A A A+NG Sbjct: 260 GDGKSRCFGFVNFENPEDAARAVEALNG 287 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 122 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKL 214 S G R+YVG L G+ LE F++ GK+ Sbjct: 245 SGSGNRLYVGNLSWGVDDMALENLFNEQGKV 275 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 122 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKL 214 S G R+YVG L G+ LE F++ GK+ Sbjct: 253 SGSGNRLYVGNLSWGVDDMALENLFNEQGKV 283 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKL 214 T+V+VGGL +++ R FD++G++ Sbjct: 17 TKVFVGGLAWETPTDEMRRYFDQFGEI 43 >At1g05510.1 68414.m00563 expressed protein Length = 241 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 131 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVW 226 G +++ G+ E I+++DLE+ YGK+ W Sbjct: 121 GGFLFMPGVPEAIQRQDLEKVAKTYGKVYHFW 152 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 131 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 247 GT++Y+ L G+ ED++ F + G+L V + G Sbjct: 85 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSG 123 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 131 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 247 GT++Y+ L G+ ED++ F + G+L V + G Sbjct: 21 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSG 59 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 131 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 247 GT++Y+ L G+ ED++ F + G+L V + G Sbjct: 87 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSG 125 >At5g47330.1 68418.m05834 palmitoyl protein thioesterase family protein Length = 314 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 320 NISVPFIALHASSASCKFSNSMKRNLGDLV 231 ++SVPFI LH SA C SN+ N L+ Sbjct: 24 SVSVPFIMLHGISAQC--SNARDANFTQLL 51 >At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 363 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 140 VYVGGLVEGIKKEDLEREFDKYGKLNSVWV 229 +YVGGL I ++D+ F YG++ S+ V Sbjct: 227 LYVGGLNSRIFEQDIHDHFYAYGEMESIRV 256 >At5g44770.1 68418.m05487 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 541 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 Query: 332 KVAPNISVPFIALHASSASCKFSNSMKRNLGDLV 231 +V PN ++ CKFS MK+ LGDLV Sbjct: 495 EVLPNNGATRPFCNSCKVRCKFSFLMKQTLGDLV 528 >At5g02530.1 68418.m00187 RNA and export factor-binding protein, putative BcDNA.LD24793, Drosophila melanogaster, EMBL:AF172637 Length = 292 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +2 Query: 131 GTRVYVGGLVEGIKKEDLEREFDKYGKL 214 GT++Y+ L G+ ED++ F + G L Sbjct: 107 GTKLYISNLDYGVSNEDIKELFSEVGDL 134 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 134 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWV 229 T VYV L+E + + L F +YG ++SV V Sbjct: 202 TNVYVKNLIETVTDDCLHTLFSQYGTVSSVVV 233 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 140 VYVGGLVEGIKKEDLEREFDKYGKLNSV 223 VYVG + DLER F K+G++ V Sbjct: 4 VYVGNFDYDTRHSDLERLFSKFGRVKRV 31 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 122 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKL 214 + G RVYVG L G+ LE F + GK+ Sbjct: 200 AGSGNRVYVGNLSWGVDDMALESLFSEQGKV 230 >At1g60490.1 68414.m06810 phosphatidylinositol 3-kinase (PI3K) identical to SP|P42339 Phosphatidylinositol 3-kinase (EC 2.7.1.137) (PI3-kinase) (PtdIns-3- kinase) (PI3K) {Arabidopsis thaliana} Length = 814 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = +1 Query: 202 IWKTKLSLGSTKSPRFRF---IEFENLQEAEDACSAMNGTEMLGATLKVEI 345 +WK + SL S K +F +E+ ++QEA+ A M EM+ +E+ Sbjct: 307 LWKFRFSLMSEKRALTKFLRCVEWSDVQEAKQAIQLMYKWEMIDVCDALEL 357 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,201,690 Number of Sequences: 28952 Number of extensions: 189747 Number of successful extensions: 721 Number of sequences better than 10.0: 87 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 721 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -