BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30397 (406 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 23 1.5 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 3.5 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 21 4.6 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 21 4.6 S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 20 8.0 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 20 8.0 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.6 bits (46), Expect = 1.5 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +3 Query: 225 SANPD-ELVQEICKNPYSQNLLMHV*KLFNLNNIMKLN 335 S +P+ L I NPY + + L LNNI L+ Sbjct: 331 STSPNLPLTHNIAHNPYPSHSIYPSSNLMPLNNIQNLS 368 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.4 bits (43), Expect = 3.5 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = -1 Query: 151 NKLSLSNGTVS---SVGYKFSTACFTPIVCFGGDGGLI 47 +K ++S V S G S CF P +C G G L+ Sbjct: 33 SKFAISENAVKPCVSCGPGQSGQCFGPSICCGPFGCLV 70 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 21.0 bits (42), Expect = 4.6 Identities = 11/52 (21%), Positives = 25/52 (48%) Frame = +3 Query: 183 ENPHVREILELLDSSANPDELVQEICKNPYSQNLLMHV*KLFNLNNIMKLNI 338 +NP+++ +L + ++A+PD V +N+ + F N L++ Sbjct: 91 KNPNLKVMLSVGGATASPDSFVAAANDPEKMKNMTSSAIEFFETYNYDGLDV 142 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 21.0 bits (42), Expect = 4.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 195 VREILELLDSSANPDELVQEICKNPY 272 ++ L LLDSS P+ L+ N Y Sbjct: 4 IKNKLLLLDSSTQPNYLILSNKNNTY 29 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 20.2 bits (40), Expect = 8.0 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +1 Query: 106 YTLQKIRYHW 135 YT++ IRY W Sbjct: 8 YTMRDIRYKW 17 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 20.2 bits (40), Expect = 8.0 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +1 Query: 106 YTLQKIRYHW 135 YT++ IRY W Sbjct: 190 YTMRDIRYKW 199 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,233 Number of Sequences: 336 Number of extensions: 1647 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8752267 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -