BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30397 (406 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 24 2.4 AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 23 3.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 4.2 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 5.6 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 5.6 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 5.6 EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519477-2|ABP73564.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519475-2|ABP73560.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519472-2|ABP73554.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519466-2|ABP73542.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519465-2|ABP73540.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. 22 7.4 EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. 22 7.4 EF519458-2|ABP73526.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519457-2|ABP73524.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519456-2|ABP73522.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. 22 7.4 EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. 22 7.4 EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. 22 7.4 EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519448-2|ABP73506.1| 171|Anopheles gambiae CTL4 protein. 22 7.4 EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519445-2|ABP73500.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. 22 7.4 EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. 22 7.4 EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. 22 7.4 EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. 22 7.4 EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. 22 7.4 EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. 22 7.4 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 22 7.4 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 22 9.8 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 23.8 bits (49), Expect = 2.4 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 213 LLDSSANPDELVQEICKNPYSQNLLMHV 296 L ++ PDE V +P SQN L H+ Sbjct: 224 LFETVGFPDEPVSGHSTDPLSQNYLTHI 251 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 23.4 bits (48), Expect = 3.2 Identities = 12/41 (29%), Positives = 16/41 (39%) Frame = +3 Query: 9 SVACYKLHKQNPCIKPPSPPKQTIGVKQAVENLYPTEDTVP 131 + A YK K P PPK I + N+ P +P Sbjct: 53 TTAAYKAGKIAPNPFTAGPPKPNISIPPPTMNMPPRPGMIP 93 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 4.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 51 KPPSPPKQTIGV 86 +P SPP QTIG+ Sbjct: 1388 QPSSPPTQTIGI 1399 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 22.6 bits (46), Expect = 5.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 94 ACFTPIVCFGGDGGLIQG 41 AC +PI+ FGG G G Sbjct: 534 ACLSPIITFGGLLGTATG 551 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 22.6 bits (46), Expect = 5.6 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = -1 Query: 343 DTIFSFMILLRLNNFQTCINKFCEYGFL 260 DT + L +N +N+ C +G+L Sbjct: 671 DTFSTLWFCLAMNPLSRTLNQQCNFGYL 698 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 22.6 bits (46), Expect = 5.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 22 INYTNKILVSNHRPRRNKQ 78 I+ T ILVS+HR R+ Q Sbjct: 682 ISKTEYILVSSHRSRQESQ 700 >EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519477-2|ABP73564.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519475-2|ABP73560.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519472-2|ABP73554.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519466-2|ABP73542.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519465-2|ABP73540.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 39 KLYTTPNLRLNWFDAV 54 >EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 39 KLYTTPNLRLNWFDAV 54 >EF519458-2|ABP73526.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519457-2|ABP73524.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519456-2|ABP73522.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 34 KLYTTPNLRLNWFDAV 49 >EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 44 KLYTTPNLRLNWFDAV 59 >EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 44 KLYTTPNLRLNWFDAV 59 >EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519448-2|ABP73506.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 44 KLYTTPNLRLNWFDAV 59 >EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519445-2|ABP73500.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 50 KLYTTPNLRLNWFDAV 65 >EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. Length = 164 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 37 KLYTTPNLRLNWFDAV 52 >EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 38 KLYTTPNLRLNWFDAV 53 >EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. Length = 152 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 25 KLYTTPNLRLNWFDAV 40 >EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 34 KLYTTPNLRLNWFDAV 49 >EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 100 KIYTLQKIRYHWIDSI 147 K+YT +R +W D++ Sbjct: 38 KLYTTPNLRLNWFDAV 53 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 22.2 bits (45), Expect = 7.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 Query: 186 NPHVREILELLDSSANPDELV 248 N +RE+ +LL+S + DE+V Sbjct: 1502 NNKLRELYKLLNSDTHQDEVV 1522 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 21.8 bits (44), Expect = 9.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 58 GGLIQGFCLCNL*QATEQ 5 G L G+C+C+L +AT Q Sbjct: 310 GKLKVGWCVCSLREATVQ 327 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 372,456 Number of Sequences: 2352 Number of extensions: 6990 Number of successful extensions: 56 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32494788 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -