BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30394 (836 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07671.1 68415.m00894 H+-transporting two-sector ATPase, C su... 44 2e-04 At3g16160.1 68416.m02040 tesmin/TSO1-like CXC domain-containing ... 29 3.8 At1g61610.1 68414.m06942 S-locus lectin protein kinase family pr... 28 6.7 At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR... 28 8.8 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 28 8.8 >At2g07671.1 68415.m00894 H+-transporting two-sector ATPase, C subunit family protein similar to ATPase subunit 9 [Arabidopsis thaliana] GI:15215920; contains Pfam profile PF00137: ATP synthase subunit C Length = 85 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 305 FGSLIIGYARNPSLKQQLFSYAILGFALSE 394 F SLI ARNPSL +Q F YAILGFAL+E Sbjct: 39 FSSLIHSVARNPSLAKQSFGYAILGFALTE 68 >At3g16160.1 68416.m02040 tesmin/TSO1-like CXC domain-containing protein low similarity to cysteine-rich polycomb-like protein (cpp1) [Glycine max] GI:4218187; contains Pfam profile PF03638: Tesmin/TSO1-like CXC domain Length = 360 Score = 29.1 bits (62), Expect = 3.8 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +1 Query: 169 SLHSSLQCGPSRPHRSLR--TLTLLPNSLVLCS 261 +L S + C P P+RSL T TLLP+ LCS Sbjct: 225 ALGSPMSCSPKLPYRSLMGYTSTLLPDLGDLCS 257 >At1g61610.1 68414.m06942 S-locus lectin protein kinase family protein similar to KI domain interacting kinase 1 [Zea mays] gi|2735017|gb|AAB93834; contains S-locus glycoprotein family domain, Pfam:PF00954 Length = 842 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 247 LVLCSDSGSSWFRSWYWNSLRLP 315 LVLCSDS R WYW S P Sbjct: 135 LVLCSDSDR---RKWYWESFNNP 154 >At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1095 Score = 27.9 bits (59), Expect = 8.8 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 40 LIKTKCCLPPD*SPLQPGLPSSATLH--WCDHLQQYPPI 150 L++ CC + P LPS LH +C LQ +P I Sbjct: 682 LLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEI 720 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -2 Query: 244 NLAAESMSLVTDVVWKDRTAESCVGTAGTICVWVGTAASGRTS 116 N+A+E + L+ ++ CV +C+ VG ++SG+TS Sbjct: 2028 NIASEQLKLLPEIRQNLEAVAHCVQNKW-LCILVGPSSSGKTS 2069 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,339,800 Number of Sequences: 28952 Number of extensions: 389431 Number of successful extensions: 1086 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1085 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1931371200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -