BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30391 (302 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) simi... 89 5e-19 At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) simi... 89 7e-19 At1g04030.1 68414.m00390 expressed protein 32 0.064 At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, A... 32 0.085 At4g37950.1 68417.m05365 expressed protein 28 1.4 At3g48200.1 68416.m05259 expressed protein 28 1.4 At3g13760.1 68416.m01736 DC1 domain-containing protein contains ... 27 1.8 At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containi... 27 2.4 At5g56560.1 68418.m07058 F-box family protein contains F-box dom... 27 3.2 At4g01925.1 68417.m00256 DC1 domain-containing protein low simil... 26 4.2 At3g25950.1 68416.m03234 hypothetical protein 26 5.6 At5g35550.1 68418.m04229 myb family transcription factor (MYB123... 25 7.4 At4g35940.1 68417.m05113 expressed protein 25 7.4 At3g17010.1 68416.m02172 transcriptional factor B3 family protei... 25 7.4 At1g65120.2 68414.m07382 ubiquitin carboxyl-terminal hydrolase-r... 25 7.4 At1g65120.1 68414.m07383 ubiquitin carboxyl-terminal hydrolase-r... 25 7.4 At5g47225.1 68418.m05823 hypothetical protein 25 9.7 At5g24790.1 68418.m02927 expressed protein contains Pfam profile... 25 9.7 At5g16850.1 68418.m01974 telomerase reverse transcriptase (TERT)... 25 9.7 At5g12940.1 68418.m01484 leucine-rich repeat family protein cont... 25 9.7 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 25 9.7 >At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) similar to 60S ribosomal protein L29 GB:P25886 from (Rattus norvegicus) Length = 83 Score = 89.0 bits (211), Expect = 5e-19 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = +1 Query: 31 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLK 189 +MAKSKNHT HNQ+ KAH+NGIKKPR+ RH T GMDPKFLRNQR+ +K N+K Sbjct: 22 EMAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVK 74 >At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) similar to ribosomal protein L29 GI:7959366 [Panax ginseng] Length = 61 Score = 88.6 bits (210), Expect = 7e-19 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +1 Query: 34 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLK 189 MAKSKNHT HNQ+ KAH+NGIKKPR+ RH T GMDPKFLRNQR+ +K N+K Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVK 52 >At1g04030.1 68414.m00390 expressed protein Length = 418 Score = 32.3 bits (70), Expect = 0.064 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 31 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK 147 K AKSK T Q++K + N I + R S+ G DP+ Sbjct: 215 KSAKSKGRTKQKQSQKENSNFIADQEEKRDSSSFGTDPQ 253 >At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, Arabidopsis thaliana, AJ011845 Length = 400 Score = 31.9 bits (69), Expect = 0.085 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 46 KNHTNHNQNRKAHRNGIKKPRKTRHESTLG 135 KNHT H++ R ++ G K RKT +T G Sbjct: 88 KNHTFHHKMRMSYSEGSKMKRKTHRNTTFG 117 >At4g37950.1 68417.m05365 expressed protein Length = 678 Score = 27.9 bits (59), Expect = 1.4 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 26 ASKWQSQ-RIIQIITKTAKLTEMVSKSQGRPGTNPPLAWIQNF*GIKGFARRVT 184 A WQ++ + Q T+ K+ M + + RPGT AW+ F G + R +T Sbjct: 408 AGSWQTENKGYQFWTRADKMG-MFTIANVRPGTYSLYAWVSGFIGDYKYVRDIT 460 >At3g48200.1 68416.m05259 expressed protein Length = 1088 Score = 27.9 bits (59), Expect = 1.4 Identities = 17/57 (29%), Positives = 25/57 (43%) Frame = +1 Query: 22 KRIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKP 192 ++I +A S H+ K H N I T ES G+ + + F + NLKP Sbjct: 546 EQIMVATSPYIGPHSFISKTHNNMINLKTSTNAESVFGLPLTAMEYRLFFETSNLKP 602 >At3g13760.1 68416.m01736 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 652 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 94 YHFCELCGFGYDLYDSLTLPF*CVFNP 14 ++ C +CGF DL +LTLP + NP Sbjct: 182 FYRCLICGFCLDLSCALTLPPLTIANP 208 >At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containing protein contains multiple PPR repeats Pfam Profile: PF01535 Length = 426 Score = 27.1 bits (57), Expect = 2.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 94 YHFCELCGFGYDLYDSLTLPF*CVFNPLRF 5 +H E+CG G+DLY S + C+ RF Sbjct: 33 FHHMEVCGIGHDLY-SYNIVINCLCRCSRF 61 >At5g56560.1 68418.m07058 F-box family protein contains F-box domain Pfam:PF00646 Length = 607 Score = 26.6 bits (56), Expect = 3.2 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 181 YPSCKTFDSLKILDPCQGWIRAWSSL 104 YP+C F SLK L+ C R W++L Sbjct: 475 YPACTVFSSLKYLELCTCSAR-WANL 499 >At4g01925.1 68417.m00256 DC1 domain-containing protein low similarity to UV-B light insensitive ULI3 [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 399 Score = 26.2 bits (55), Expect = 4.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 94 YHFCELCGFGYDLYDSLTLP 35 YH CE CGF DLY ++ P Sbjct: 65 YH-CETCGFDVDLYCAMYPP 83 >At3g25950.1 68416.m03234 hypothetical protein Length = 251 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 135 AKGGFVPGLPWLFDTISVSFAVLVMICMIL 46 A G VP WL + + FA+LV I +L Sbjct: 205 AADGVVPRWAWLSWLVVIGFAILVSILWVL 234 >At5g35550.1 68418.m04229 myb family transcription factor (MYB123) contains PFAM profile: myb DNA-binding domain PF00249 Length = 258 Score = 25.4 bits (53), Expect = 7.4 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +1 Query: 46 KNHTNHNQNRKAHRNGIKKPRKTRHES 126 KNH N N ++ + K+P++ +H + Sbjct: 107 KNHWNSNLRKRLPKTQTKQPKRIKHST 133 >At4g35940.1 68417.m05113 expressed protein Length = 451 Score = 25.4 bits (53), Expect = 7.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 173 RRVT*SQPSNSRGRLREKLPEKQRP 247 +R+ QP N R +EK EKQ+P Sbjct: 230 KRIEKQQPLNGRHNNKEKQKEKQQP 254 >At3g17010.1 68416.m02172 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 302 Score = 25.4 bits (53), Expect = 7.4 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 40 KSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKF 150 K K + + +K RN +KK K++ + L P+F Sbjct: 166 KKKTEDSKSSKKKMTRNKVKKKSKSKSKQVLDGVPEF 202 >At1g65120.2 68414.m07382 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1147 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +1 Query: 46 KNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK 147 K+ +N +NR R + HES++ ++PK Sbjct: 751 KSGSNKKKNRSNKRTSASMSKDDVHESSVNLEPK 784 >At1g65120.1 68414.m07383 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1121 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +1 Query: 46 KNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK 147 K+ +N +NR R + HES++ ++PK Sbjct: 751 KSGSNKKKNRSNKRTSASMSKDDVHESSVNLEPK 784 >At5g47225.1 68418.m05823 hypothetical protein Length = 351 Score = 25.0 bits (52), Expect = 9.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 226 LFSQPPSRVAWLASGYPS 173 +F PP+R W SG PS Sbjct: 87 IFECPPARQVWALSGIPS 104 >At5g24790.1 68418.m02927 expressed protein contains Pfam profile PF04654: Protein of unknown function, DUF599 Length = 246 Score = 25.0 bits (52), Expect = 9.7 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 105 WLFDTISVSFAVLVMICMIL*LCHFDAFSIHLDSE 1 W+F I V F+VLV M+L L H D S + + E Sbjct: 196 WIFGPILVFFSVLV---MVLVLSHLDFVSRNNNKE 227 >At5g16850.1 68418.m01974 telomerase reverse transcriptase (TERT) identical to telomerase reverse transcriptase [Arabidopsis thaliana] GI:5880683 Length = 1123 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 217 QPPSRVAWLASGYPSCKTFDSLKI 146 QPP++ WL+S C DS I Sbjct: 201 QPPTKRQWLSSAVDDCPKDDSATI 224 >At5g12940.1 68418.m01484 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 371 Score = 25.0 bits (52), Expect = 9.7 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Frame = -2 Query: 271 LLITNVISWPLLLG*LFSQPPSRVAWLAS-----GYPSCKTFDSLKILDPCQGW 125 +L+TNV+ + LL + S PS A L P F++ K LD C+GW Sbjct: 9 ILLTNVVVFLLLSTTVHSCLPSDRAALLEFRAKLNEPYIGVFNTWKGLDCCKGW 62 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -2 Query: 166 TFDSLKILDPCQGWIRAWSSLAF*Y-HFCELCGFGYDLYDSL 44 TFD L + QGW + ++ L+ Y G+ +Y+S+ Sbjct: 275 TFDGLNTIVRTQGWKQLFAGLSINYIKIVPSVAIGFTVYESM 316 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,858,447 Number of Sequences: 28952 Number of extensions: 108754 Number of successful extensions: 343 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 343 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 301317600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -