BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30390 (788 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 24 4.7 AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like pepti... 24 6.2 AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like pepti... 24 6.2 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 8.1 AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. 23 8.1 AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. 23 8.1 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 24.2 bits (50), Expect = 4.7 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +2 Query: 47 SLKSYWLKVYYLNVNMSAQRSRRKLKNNARCLFTCTLIWNYSSVS 181 S +S+ ++ N Q K KN C TC W Y S+S Sbjct: 178 SAQSFRVQKKQTKQNKKIQIKHTKTKNGC-CRKTCGTGWKYRSIS 221 >AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 23.8 bits (49), Expect = 6.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 419 KPWHSFFHSRCNLGKLSNHL 360 K WH HSRC KL HL Sbjct: 41 KVWHQESHSRCR-EKLIRHL 59 >AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 23.8 bits (49), Expect = 6.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 419 KPWHSFFHSRCNLGKLSNHL 360 K WH HSRC KL HL Sbjct: 41 KVWHQESHSRCR-EKLIRHL 59 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 760 TSLVFRIYAHSNPPNFRPCRQAVVPE 683 TSL +Y HS P PCR ++P+ Sbjct: 1301 TSLSALVYQHSITPLALPCR-LIIPD 1325 >AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 23.4 bits (48), Expect = 8.1 Identities = 13/47 (27%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -1 Query: 788 PGCAPPPLENEPCFSNIRSF---ESTKFPTLSASCSARACIRVGSER 657 PGC P P+ + C S+ +K + SC C + ER Sbjct: 51 PGCVPKPIPSFACIGRCASYIQVSGSKIWQMERSC---MCCQESGER 94 >AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 23.4 bits (48), Expect = 8.1 Identities = 13/47 (27%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -1 Query: 788 PGCAPPPLENEPCFSNIRSF---ESTKFPTLSASCSARACIRVGSER 657 PGC P P+ + C S+ +K + SC C + ER Sbjct: 51 PGCVPKPIPSFACIGRCASYIQVSGSKIWQMERSC---MCCQESGER 94 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 833,553 Number of Sequences: 2352 Number of extensions: 16460 Number of successful extensions: 35 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -