BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30389 (790 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0303 + 14792842-14792949,14793659-14793760,14794657-147948... 45 6e-05 06_03_1325 - 29334401-29334859,29335163-29335857,29336538-293367... 42 4e-04 08_02_1159 + 24773328-24773994,24775430-24775558,24776080-247762... 41 0.001 10_02_0091 - 5190536-5191794,5191878-5192030,5192501-5193099,519... 39 0.004 09_02_0533 - 10325681-10326211,10326260-10326328,10326758-103268... 39 0.005 04_03_0604 - 17916482-17917659,17918121-17918291,17919015-17919966 38 0.012 09_04_0479 - 17948043-17949037,17949554-17949715,17949809-179502... 37 0.016 09_04_0472 - 17895285-17896459,17897113-17897271,17897374-178977... 37 0.021 04_04_1120 + 31037811-31038813,31038903-31038991,31039094-310391... 36 0.028 09_04_0477 - 17932797-17933974,17934454-17934612,17934693-17934957 36 0.037 06_03_1036 + 27053480-27053729,27054616-27054704,27054881-270549... 36 0.037 03_02_0917 + 12372122-12372422,12372487-12372524,12373103-123731... 36 0.049 12_01_0101 - 779047-779298,779459-779711,779857-780005,780033-78... 35 0.085 11_01_0101 - 738305-738556,738723-738977,739306-739554,739649-73... 35 0.085 09_03_0111 - 12440818-12441129,12441242-12441585,12441663-124419... 35 0.085 02_05_0005 - 24890239-24891419,24891524-24891694,24891810-24892704 35 0.085 07_03_1693 - 28756331-28756435,28756558-28756664,28757114-287572... 34 0.11 04_01_0609 + 7966263-7966366,7967945-7968706,7972607-7972851,797... 34 0.11 12_02_1104 + 26121288-26122200,26122324-26122506,26122841-26124009 34 0.15 02_05_0004 - 24880826-24882033,24882106-24882276,24882360-24883203 34 0.15 10_02_0060 - 4808506-4808535,4808564-4809588,4810125-4810292,481... 33 0.26 09_04_0476 - 17922072-17922469,17922546-17923241,17923405-179235... 33 0.26 04_04_1396 + 33227126-33227846,33228530-33228637,33228825-33230029 33 0.26 02_05_1156 - 34528204-34529411,34529982-34530122,34530214-34531072 33 0.26 03_05_0466 - 24602715-24603964,24605762-24605944,24606381-246072... 33 0.34 11_08_0023 + 27741775-27742475,27744163-27744413,27744557-277447... 32 0.45 09_06_0278 + 21991016-21992120,21992341-21992702,21992766-219934... 32 0.45 09_04_0473 - 17906802-17907964,17908175-17908871,17910323-17910784 32 0.45 01_03_0307 + 14879564-14879594,14880024-14880182,14880629-14881857 32 0.45 12_02_1105 + 26128108-26129032,26129535-26129663,26129924-26131104 31 0.79 10_01_0054 - 773395-774518,776957-777124,777455-778376 31 0.79 08_02_1157 + 24765719-24766544,24766569-24766637,24767031-247671... 31 0.79 07_01_0495 + 3722319-3722517,3723325-3723482,3723652-3723929,372... 31 0.79 04_01_0148 + 1710369-1710531,1711821-1712279,1712769-1712915,171... 31 0.79 11_08_0007 + 27551173-27551828,27552071-27552282,27553371-275535... 31 1.4 11_02_0042 - 7672565-7672729,7672902-7672977,7673409-7674132,767... 30 1.8 04_03_0602 - 17884667-17885817,17885946-17886113,17886413-17887313 30 1.8 02_05_1158 - 34550049-34551241,34551354-34551521,34551847-345522... 30 1.8 01_01_0707 - 5453933-5454619 30 1.8 09_04_0475 - 17913982-17914772,17914830-17915156,17915323-179154... 30 2.4 08_02_1286 - 25882773-25883771 30 2.4 08_02_0421 - 16932354-16932427,16932909-16933076,16933443-16934544 30 2.4 01_06_1123 + 34671365-34671883,34672366-34672625,34673045-346731... 30 2.4 09_06_0280 + 22010270-22011407,22011890-22013097 29 3.2 05_01_0242 + 1804183-1806096 29 3.2 03_03_0091 - 14371528-14372661 29 3.2 12_01_0377 - 2939384-2939505,2939629-2939695,2940324-2940543,294... 29 4.2 05_05_0036 - 21758409-21758531,21758891-21759206,21759964-217611... 29 4.2 03_02_0359 - 7788382-7788522,7788931-7789837,7791227-7791337,779... 29 4.2 12_02_1103 + 26116614-26117607,26118060-26118242,26118344-26119518 29 5.6 11_08_0019 + 27697918-27698609,27701107-27701372,27701778-277019... 29 5.6 10_08_0514 + 18465474-18465760,18465888-18465978,18466670-184667... 29 5.6 07_01_0639 - 4785446-4786186,4786429-4786656,4786727-4786872,478... 29 5.6 07_01_0286 + 2086630-2086856,2087052-2087067 29 5.6 06_01_1133 + 9364842-9364850,9364929-9365048,9365157-9365476,936... 29 5.6 05_03_0362 - 12973488-12974251,12975346-12975580,12976410-129767... 29 5.6 05_03_0170 - 9132207-9133010,9133232-9133894 29 5.6 04_03_0588 + 17595299-17596151,17597519-17597665,17598562-175988... 29 5.6 04_03_0184 + 12395349-12395542,12396821-12397467,12398119-123986... 29 5.6 03_02_0580 + 9615646-9616647 29 5.6 02_05_1153 - 34501778-34502961,34503052-34503219,34503306-34504263 29 5.6 11_08_0003 + 27492503-27492812,27492863-27493148,27495399-274956... 28 9.7 05_06_0057 + 25253497-25253589,25253722-25253799,25254583-252546... 28 9.7 05_03_0491 + 14682895-14683365,14684127-14684656,14684739-14685213 28 9.7 04_04_0176 - 23329589-23331043 28 9.7 >01_03_0303 + 14792842-14792949,14793659-14793760,14794657-14794800, 14794906-14794986,14795078-14795147,14795267-14795337, 14795427-14795594,14796030-14796074,14796449-14796511, 14796594-14796869,14797858-14797971,14798099-14798225, 14798315-14798484,14798743-14798841,14799577-14799630, 14801487-14801522,14801741-14801844,14801952-14802186, 14802377-14802609,14802846-14803346,14803422-14803716, 14805796-14805881,14806952-14807064,14807303-14807385, 14808014-14808866,14809215-14809364,14809963-14811146 Length = 1854 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/56 (37%), Positives = 28/56 (50%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 GN + C+DV+EC ++ CP+G C NT G Y C G T C +PD Sbjct: 1401 GNPYITDGCIDVNECEQNQSPCPKGATCRNTEGWYHCSCPVGRKLAKETNTC-NPD 1455 >06_03_1325 - 29334401-29334859,29335163-29335857,29336538-29336750, 29338791-29339472,29339781-29340020 Length = 762 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC-VPCGGH 399 GN C D+D CA G CP G +C N PG + C P G H Sbjct: 298 GNPYLPGGCTDIDVCAPGNDGCPDGMICSNFPGGHNCSCPEGEH 341 >08_02_1159 + 24773328-24773994,24775430-24775558,24776080-24776220, 24777393-24777487,24777545-24778606 Length = 697 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 GN C D++ECA+ G LC+NTPG+++C G Y Sbjct: 256 GNASILNGCQDINECAEPEKYSCYGGLCINTPGAFVCRCHDGSY 299 >10_02_0091 - 5190536-5191794,5191878-5192030,5192501-5193099, 5193771-5193837,5194177-5195170 Length = 1023 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/49 (40%), Positives = 27/49 (55%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 PG+RG N + C D+DEC + C +G +C NT G+Y C C H Sbjct: 540 PGYRG--NPYILDGCEDIDECRETPGIC-KG-VCKNTVGNYSCTKCPDH 584 >09_02_0533 - 10325681-10326211,10326260-10326328,10326758-10326855, 10326968-10327117,10327848-10327976,10328063-10328999 Length = 637 Score = 38.7 bits (86), Expect = 0.005 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Frame = +1 Query: 217 HLWAVSSRVHR*PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC-VPCG 393 H + + + H G++G N R C D+DEC + G C NTPGS+IC P G Sbjct: 287 HAYDLGYKCHCSDGYQG--NPYIRGGCHDIDECKSPQDYSCYGN-CNNTPGSHICDCPRG 343 Query: 394 GHYYVNTTRPCFDPD 438 +T C D D Sbjct: 344 YERNASTPNGCKDID 358 >04_03_0604 - 17916482-17917659,17918121-17918291,17919015-17919966 Length = 766 Score = 37.5 bits (83), Expect = 0.012 Identities = 25/74 (33%), Positives = 30/74 (40%), Gaps = 7/74 (9%) Frame = +2 Query: 2 ETVGSASTCVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYT------CVDMDEC- 160 ET A V + + +C S P Y C C GYQ N Y C D+DEC Sbjct: 265 ETCDKARRKVDTYACVSHNSKCFNSSNGPGYICN-CSEGYQGNPYLQDGQHGCTDIDECA 323 Query: 161 DLIRPCDDLVSCRN 202 D PC +C N Sbjct: 324 DPKYPCSVPGTCHN 337 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 256 GWRGTGNERRREH-CVDVDECADGRANCPRGRLCVNTPGSYICV 384 G++G + +H C D+DECAD + C C N PG + C+ Sbjct: 302 GYQGNPYLQDGQHGCTDIDECADPKYPCSVPGTCHNLPGGFECL 345 >09_04_0479 - 17948043-17949037,17949554-17949715,17949809-17950262, 17952895-17953326 Length = 680 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 GN ++ C D+DEC + A P +C NT G++ C G Y +N Sbjct: 286 GNPYIKDGCKDIDECLNN-ATYPCKGICTNTLGNFTCSCSPGSYMMN 331 >09_04_0472 - 17895285-17896459,17897113-17897271,17897374-17897794, 17898520-17898552,17898902-17899384 Length = 756 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 GN ++ C D++EC D A P +C NT G++ C G+Y +N Sbjct: 303 GNPYVKDGCKDINECLDN-ATYPCPGICKNTLGNFTCSCYPGNYMMN 348 >04_04_1120 + 31037811-31038813,31038903-31038991,31039094-31039163, 31039270-31039353,31039452-31039528,31039631-31039712, 31039847-31039929,31040270-31040333,31040435-31040566, 31040674-31040777,31040901-31040996,31041144-31041251 Length = 663 Score = 36.3 bits (80), Expect = 0.028 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRA-NCPRGRLCVNTPGSYICVPCGGH--YYVNTTRP 423 PG++G G HC DVDEC++ A +CP C NT GS+ C C G+ Y+ Sbjct: 507 PGFKGDGL-----HCEDVDECSEKLACSCPHCS-CKNTWGSFDC-SCHGNNLMYIKAEDT 559 Query: 424 C 426 C Sbjct: 560 C 560 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDLIRPCD-DLVSCRN 202 CP G++ +G C D+DEC C SC+N Sbjct: 505 CPPGFKGDGLHCEDVDECSEKLACSCPHCSCKN 537 >09_04_0477 - 17932797-17933974,17934454-17934612,17934693-17934957 Length = 533 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 GN ++ C D++EC D P +C NT GS+ C G+Y N T Sbjct: 79 GNPYIKDGCEDINECLDN-VTYPCPGICNNTMGSFTCSCHQGNYMENGT 126 >06_03_1036 + 27053480-27053729,27054616-27054704,27054881-27054950, 27055145-27055228,27055332-27055408,27055519-27055583, 27055723-27055765,27055889-27055952,27056126-27056254, 27056522-27056625,27056724-27056828 Length = 359 Score = 35.9 bits (79), Expect = 0.037 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRA-NCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 PG++G G++ C D+DEC + A CP C NT G+Y C G Y+ C Sbjct: 237 PGFQGDGHK-----CEDLDECKEKLACTCPNCH-CKNTWGNYECKCKGNQIYIRGEDTC 289 Score = 32.3 bits (70), Expect = 0.45 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 CP G+Q +G+ C D+DEC Sbjct: 235 CPPGFQGDGHKCEDLDEC 252 >03_02_0917 + 12372122-12372422,12372487-12372524,12373103-12373186, 12373796-12374504,12374641-12374729,12374834-12374903, 12374977-12375060,12375097-12375239,12375337-12375418, 12375605-12375687,12375769-12375835,12376287-12376376, 12377631-12377737,12377862-12377969 Length = 684 Score = 35.5 bits (78), Expect = 0.049 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGG 396 PG++G G + C D+DEC + +G C NT GSY C CGG Sbjct: 572 PGFKGDGIKS----CEDIDECKEKLYCQCKGCSCENTWGSYEC-SCGG 614 >12_01_0101 - 779047-779298,779459-779711,779857-780005,780033-780281, 780377-780571,780681-780788,780935-781156,781669-781986, 781988-782615,783059-783135,783161-783267,783491-783619, 783763-783820,783902-783984,784458-784539,784617-784693, 784827-784910,784999-785068,785146-785234,785319-786008, 786485-786797 Length = 1410 Score = 34.7 bits (76), Expect = 0.085 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 G++G G + C D+DEC + A + C NT GSY C GG Y+ C Sbjct: 505 GFKGDGVHK----CEDIDECKERTACQCKECKCKNTWGSYECGCSGGLLYMKEHDTCISK 560 Query: 436 DS 441 ++ Sbjct: 561 NA 562 >11_01_0101 - 738305-738556,738723-738977,739306-739554,739649-739843, 739953-740060,740184-740405,740806-741390,741495-741863, 742423-742529,742755-742883,743027-743084,743166-743248, 744115-744196,744274-744350,744477-744560,744649-744718, 744796-744884,744965-745654,746127-746439 Length = 1338 Score = 34.7 bits (76), Expect = 0.085 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 G++G G + C D+DEC + A + C NT GSY C GG Y+ C Sbjct: 505 GFKGDGVHK----CEDIDECKERTACQCKECKCKNTWGSYECGCSGGLLYMKEHDTCISK 560 Query: 436 DS 441 ++ Sbjct: 561 NA 562 >09_03_0111 - 12440818-12441129,12441242-12441585,12441663-12441989, 12443444-12443602,12443687-12443784,12444745-12444821 Length = 438 Score = 34.7 bits (76), Expect = 0.085 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 GN ++ C D++EC D A P +C NT GS+ C G Y N Sbjct: 49 GNPYIKDGCKDINECLD-NATYPCMGICKNTIGSFDCSCYPGSYMKN 94 >02_05_0005 - 24890239-24891419,24891524-24891694,24891810-24892704 Length = 748 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRAN--CPRGRLCVNTPGSYIC 381 GN + C D++EC D R C C+NTPG + C Sbjct: 289 GNPYLLDGCQDINECEDSRFKYPCSVPGTCINTPGGFRC 327 >07_03_1693 - 28756331-28756435,28756558-28756664,28757114-28757245, 28757412-28757478,28757553-28757635,28757824-28757905, 28763101-28763177,28763278-28763361,28763443-28763512, 28763625-28763713,28763801-28764487,28765700-28765997 Length = 626 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/48 (41%), Positives = 25/48 (52%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGG 396 PG++G G + C D+DEC D + C NT GSY C CGG Sbjct: 501 PGFKGDGIKS----CEDIDECKDKLFCQCKDCSCENTWGSYEC-SCGG 543 >04_01_0609 + 7966263-7966366,7967945-7968706,7972607-7972851, 7976940-7977107,7977471-7977734,7977962-7978509 Length = 696 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 GN + C DV+EC + + C G C NT GSY C Sbjct: 361 GNPYIPDGCKDVNEC-ENNSICGAGSTCKNTEGSYRC 396 >12_02_1104 + 26121288-26122200,26122324-26122506,26122841-26124009 Length = 754 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 8/65 (12%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRAN--------CPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 GN + C D+DEC + + C +G +C NTPGSYIC G T C Sbjct: 295 GNPYLSDGCQDIDECEMRKLDPKYEELYPCRKG-VCQNTPGSYICKCKKGKKSDGTGYGC 353 Query: 427 FDPDS 441 DS Sbjct: 354 QPADS 358 >02_05_0004 - 24880826-24882033,24882106-24882276,24882360-24883203 Length = 740 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRAN--CPRGRLCVNTPGSYIC 381 GN + C D++EC + R C CVNTPG + C Sbjct: 272 GNPYLLDGCQDINECDESRFRYPCSVPGTCVNTPGGFTC 310 >10_02_0060 - 4808506-4808535,4808564-4809588,4810125-4810292, 4811202-4811652 Length = 557 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +1 Query: 301 DVDECA-DG-RANCPRGRLCVNTPGSYICVPC 390 D+DECA G +NC +CVN PG + C PC Sbjct: 151 DIDECALPGIMSNCSFNSVCVNRPGGFDC-PC 181 >09_04_0476 - 17922072-17922469,17922546-17923241,17923405-17923569, 17923670-17924105,17924314-17924739 Length = 706 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 GN ++ C D++EC D P LC NT G Y C Sbjct: 278 GNPYIKDGCKDINECLD-NTTYPCAGLCQNTMGGYDC 313 >04_04_1396 + 33227126-33227846,33228530-33228637,33228825-33230029 Length = 677 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICV 384 GN R+ C D+DEC P C+N PG+Y C+ Sbjct: 231 GNPYIRDGCRDIDECQQPDV-YPCHGTCINMPGTYRCL 267 >02_05_1156 - 34528204-34529411,34529982-34530122,34530214-34531072 Length = 735 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICV 384 GN C D+DEC + C G C NT G Y+C+ Sbjct: 277 GNPYLDGGCQDIDECERDKDAC-FGNKCTNTLGGYLCM 313 >03_05_0466 - 24602715-24603964,24605762-24605944,24606381-24607286, 24609446-24609516,24609737-24609846,24610073-24610108, 24610211-24610278,24610655-24610760,24610850-24610997, 24611091-24611218,24611319-24611454,24611924-24612072 Length = 1096 Score = 32.7 bits (71), Expect = 0.34 Identities = 19/45 (42%), Positives = 22/45 (48%), Gaps = 8/45 (17%) Frame = +1 Query: 271 GNERRREHCVDVDECA---DGRAN-----CPRGRLCVNTPGSYIC 381 GN C D+DEC GR C G +C+NTPGSY C Sbjct: 610 GNPYLDNGCQDIDECTLRRQGRQYEDVYPCKHG-ICINTPGSYRC 653 >11_08_0023 + 27741775-27742475,27744163-27744413,27744557-27744715, 27744976-27745409,27745537-27746076 Length = 694 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 G+ G + C D+DEC + C G C NT G Y C Sbjct: 303 GYDGNPYLKGNGGCTDIDECKEPD-RCSTGSRCHNTEGYYYC 343 Score = 28.7 bits (61), Expect = 5.6 Identities = 22/70 (31%), Positives = 27/70 (38%), Gaps = 5/70 (7%) Frame = +2 Query: 14 SASTCVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYT-----CVDMDECDLIRPC 178 S S CV+ +S C + Y C+ C GY N Y C D+DEC C Sbjct: 276 SCSVCVSDQSD------CANATNGDGYLCK-CSEGYDGNPYLKGNGGCTDIDECKEPDRC 328 Query: 179 DDLVSCRNEE 208 C N E Sbjct: 329 STGSRCHNTE 338 >09_06_0278 + 21991016-21992120,21992341-21992702,21992766-21993459, 21994064-21994191 Length = 762 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 GN C D++EC + N G C NTPG+++C Sbjct: 312 GNPYVAGGCQDINECERAKENGCFGE-CTNTPGAFLC 347 >09_04_0473 - 17906802-17907964,17908175-17908871,17910323-17910784 Length = 773 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 D+DEC D P +C+NT GSY C G + ++ Sbjct: 338 DIDECQDAH---PCTGICINTQGSYTCTCQRGKHLID 371 >01_03_0307 + 14879564-14879594,14880024-14880182,14880629-14881857 Length = 472 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 283 RREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 RRE DV+EC + C +G C NT G Y C Sbjct: 7 RRER--DVNECEQNPSPCTKGETCRNTIGWYYC 37 >12_02_1105 + 26128108-26129032,26129535-26129663,26129924-26131104 Length = 744 Score = 31.5 bits (68), Expect = 0.79 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 8/45 (17%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRAN--------CPRGRLCVNTPGSYIC 381 GN C DVDECA + + C +G +C NTPG Y+C Sbjct: 299 GNPYLLNGCQDVDECALRKQDPKYEDIYPCRKG-VCHNTPGGYLC 342 >10_01_0054 - 773395-774518,776957-777124,777455-778376 Length = 737 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D+DECA P +C NTPG Y C Sbjct: 306 CKDIDECAHPN-KYPCHGVCRNTPGDYEC 333 >08_02_1157 + 24765719-24766544,24766569-24766637,24767031-24767180, 24767296-24768503 Length = 750 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGG 396 GN C D++EC G+ C+NT GSY C+ GG Sbjct: 289 GNPYMPNGCQDINECMLPNPPLCFGK-CINTVGSYECICPGG 329 >07_01_0495 + 3722319-3722517,3723325-3723482,3723652-3723929, 3723946-3724474 Length = 387 Score = 31.5 bits (68), Expect = 0.79 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICV 384 C D++EC + G C+NTPG Y CV Sbjct: 65 CTDINECLHPKEYGCYGN-CMNTPGGYTCV 93 >04_01_0148 + 1710369-1710531,1711821-1712279,1712769-1712915, 1713004-1714170,1714378-1714430 Length = 662 Score = 31.5 bits (68), Expect = 0.79 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +2 Query: 65 CMPKSTSPYYECEGCPSGYQWNGYT---CVDMDECDLIRPCDDLVSCRN 202 C+ +ST Y C+ C GY N Y C D+DEC L C+ +C+N Sbjct: 181 CVHRSTG--YHCK-CSLGYGGNAYIEDGCEDIDECSLPNFCNG--NCQN 224 Score = 27.9 bits (59), Expect = 9.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPC 390 GN + C D+DEC+ N G C N GSY C C Sbjct: 198 GNAYIEDGCEDIDECS--LPNFCNGN-CQNFLGSYRCSHC 234 >11_08_0007 + 27551173-27551828,27552071-27552282,27553371-27553550, 27555154-27556187 Length = 693 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +2 Query: 11 GSASTCVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYT---CVDMDECDLIRPCD 181 GS S+ + + C+ + Y C C +GY N Y C++++EC+L R Sbjct: 243 GSCSSATGAPACVSAHSYCVNATNGKGYLCN-CSAGYSGNPYVTGGCININECELRREGP 301 Query: 182 DLVSC 196 + C Sbjct: 302 AMYPC 306 >11_02_0042 - 7672565-7672729,7672902-7672977,7673409-7674132, 7674684-7674708,7675041-7675486,7676643-7676862, 7677609-7678459,7678697-7679555 Length = 1121 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +2 Query: 65 CMPKSTSPYYECEG-CPSGY-QWNGYTCVDMDECDLIRP 175 C P STS YY G PS W+G T +DE L +P Sbjct: 240 CTPVSTSSYYRYRGRNPSTVGSWDGTTAASLDEDGLNQP 278 >04_03_0602 - 17884667-17885817,17885946-17886113,17886413-17887313 Length = 739 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC-VPCG 393 G+ G C D+DEC D + + G C N PG + C P G Sbjct: 286 GYEGNPYLEGPNGCRDIDECQDSKTHHCYGE-CRNKPGGFDCNCPAG 331 >02_05_1158 - 34550049-34551241,34551354-34551521,34551847-34552231, 34552245-34552772 Length = 757 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICV 384 GN C D+DEC D G C NT G Y C+ Sbjct: 295 GNPYLDSGCTDIDECQDKEKYGCYGD-CTNTIGGYTCL 331 >01_01_0707 - 5453933-5454619 Length = 228 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = -2 Query: 348 PSPWTVGSSVSALVHIHAMFPSSLIASAPPARLPVNPGGHGPQVKP--PSSLRHETRSSQ 175 P ++++A++H H SS S+PPA P P H P+ +P P S R + + Q Sbjct: 116 PRDVQAAAALAAVMHHHKHPSSSTSTSSPPAAPP--PDEHHPRHEPQQPESSREDDQQQQ 173 >09_04_0475 - 17913982-17914772,17914830-17915156,17915323-17915493, 17915583-17915824,17915862-17916049,17916184-17916253, 17916329-17916612 Length = 690 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D++EC D P +C NT GSY C Sbjct: 260 CRDINECLDN-TTYPCAGICENTIGSYKC 287 >08_02_1286 - 25882773-25883771 Length = 332 Score = 29.9 bits (64), Expect = 2.4 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 7/98 (7%) Frame = -2 Query: 528 SNRYYKRLLSETTDGVESSAVAGVASLHQRVGVEARP-----RRVHVVVTAAGYADV*TR 364 S+R + LL T ++AVAGV GVE+ P R + V +GY++ Sbjct: 3 SHRRLRLLLLAATLAAAAAAVAGVEEEEAFCGVESMPDAATLRPDRLTVLLSGYSERRLP 62 Query: 363 GIDAKPSPWTVGSSVSALVHI--HAMFPSSLIASAPPA 256 + A + V A+V + + P SL++S PPA Sbjct: 63 LLRAIAGAYAAHPLVLAVVVLWSNPSTPDSLLSSFPPA 100 >08_02_0421 - 16932354-16932427,16932909-16933076,16933443-16934544 Length = 447 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D++EC + + P +C NT GSY C Sbjct: 366 CTDINEC-EHKDEYPCYGVCTNTAGSYAC 393 >01_06_1123 + 34671365-34671883,34672366-34672625,34673045-34673143, 34673237-34675178,34675588-34675658,34676158-34676307, 34676963-34677038,34677131-34677232,34677707-34677855, 34678214-34678364 Length = 1172 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = -2 Query: 285 SSLIASAPPARLPVNPGGHGPQVKPPSSLRHETRSSQGRIKSHSSIS 145 SSL+ ++ P RL + G + PP+S RH SS +++ S+ S Sbjct: 9 SSLLLTSSPLRLRPSAGAFALFLSPPASRRHLLLSSPAPLRTLSTAS 55 >09_06_0280 + 22010270-22011407,22011890-22013097 Length = 781 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 GN C D++EC + + G C NTPG+++C Sbjct: 323 GNPYVAGGCQDINECERPKEHGCFGE-CTNTPGAFLC 358 >05_01_0242 + 1804183-1806096 Length = 637 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -3 Query: 302 STQCSLRLSLPVPRQPGYL*TLEDTAHR 219 ST+C LRL LP+PR+ +L T T+HR Sbjct: 3 STKCRLRLLLPLPRR--HLSTAPATSHR 28 >03_03_0091 - 14371528-14372661 Length = 377 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -2 Query: 357 DAKPSPWTVGSSVSALVHIHAMFPSSLIASA 265 DA P + G++V+A H+H + P+S ASA Sbjct: 266 DALPHFFPQGAAVTATAHVHGVDPASAAASA 296 >12_01_0377 - 2939384-2939505,2939629-2939695,2940324-2940543, 2940655-2940731,2940813-2940878,2940970-2941018, 2941131-2941181,2941262-2941314,2941432-2941486, 2941563-2941651,2941742-2941827,2941933-2941989, 2942086-2942275,2943847-2944005 Length = 446 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 310 ECADGRANCPRGRLCVNTPGSYICVPCGGHYY 405 + A G+ +CP+ LC ++PG+ + P GG Y Sbjct: 101 KAAKGQKSCPQTPLCASSPGNPV-TPVGGCRY 131 >05_05_0036 - 21758409-21758531,21758891-21759206,21759964-21761121, 21761236-21761333 Length = 564 Score = 29.1 bits (62), Expect = 4.2 Identities = 20/47 (42%), Positives = 25/47 (53%) Frame = -2 Query: 615 SCSEAHYKAAARPDVRLDLCPVRTLCRCQSNRYYKRLLSETTDGVES 475 SC++ YKAA RP LCPVR C + KRLL ++ V S Sbjct: 397 SCNKMRYKAAYRPSEL--LCPVRFEWVCYDSA--KRLLDKSLYSVLS 439 >03_02_0359 - 7788382-7788522,7788931-7789837,7791227-7791337, 7791437-7791507,7791582-7791659,7792564-7792770, 7792867-7793046,7793249-7793471,7794133-7794453, 7794538-7795109 Length = 936 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -2 Query: 237 GGHGPQVKPPSSLRHETRSSQGRIKSHSSISTHVYPFHW*PLGH 106 G V PP + R E + R++SH ST FH P+ H Sbjct: 729 GWDSDMVPPPRADRDEWNFNHERVRSHMDASTSSNLFHHAPVEH 772 >12_02_1103 + 26116614-26117607,26118060-26118242,26118344-26119518 Length = 783 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 8/49 (16%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRAN--------CPRGRLCVNTPGSYICVPCG 393 GN + C D+DEC + + C G +C N PG+Y+C CG Sbjct: 322 GNPYLPKGCQDIDECKLRKEDPKYKELYPCRHG-MCQNIPGNYLC-KCG 368 >11_08_0019 + 27697918-27698609,27701107-27701372,27701778-27701948, 27702187-27703166,27703723-27703804,27704148-27704170 Length = 737 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +1 Query: 271 GNERRREHCVDVDEC--ADGRAN-CPRGRLCVNTPGSYIC 381 GN E C+D++EC + + N CP G C N G Y C Sbjct: 310 GNPYLPEGCIDINECDPSTYKENPCP-GGTCHNLEGGYKC 348 >10_08_0514 + 18465474-18465760,18465888-18465978,18466670-18466767, 18466852-18466949,18468192-18468321,18468410-18468597, 18470291-18470323,18470627-18471000,18471116-18471294, 18471421-18471532,18471655-18471771,18471875-18472189, 18472405-18472743 Length = 786 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -1 Query: 82 GAFGHTASLSSRRASERHTRAGTADR 5 G T+S SS RA++RH AG ADR Sbjct: 366 GELPSTSSSSSSRATKRHRVAGMADR 391 >07_01_0639 - 4785446-4786186,4786429-4786656,4786727-4786872, 4786986-4787186,4787256-4787432,4787741-4788359 Length = 703 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = -3 Query: 206 LRYDTRPDHHRAESNRIRPYPRT----CTHSTGSRWDILHTRNKG 84 LR P H AE + T C H GSRWD+L+ R G Sbjct: 312 LRLLALPSLHEAEEVEVAKARATLHSQCGHRRGSRWDLLNLRWPG 356 >07_01_0286 + 2086630-2086856,2087052-2087067 Length = 80 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = -1 Query: 337 DSWLVRQRTRPHPRNVPFVSHCQCPASPATCEPWRTRPTGEAAFFV 200 D WL R R PR F C P P+ T T +F V Sbjct: 35 DIWLRRDRLTGLPRRFAFAGSCTPPTPPSPSPTITTSSTARRSFTV 80 >06_01_1133 + 9364842-9364850,9364929-9365048,9365157-9365476, 9366267-9366428,9367151-9367235,9367352-9367501, 9367588-9367635,9367705-9367773,9367897-9368600, 9369426-9369561,9369636-9369856,9370355-9370486, 9371316-9371406,9371878-9371925,9372004-9372132, 9372357-9372626 Length = 897 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/69 (27%), Positives = 26/69 (37%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCR 474 C+ C + CP+ +C N + C + PCF D + CDP CR Sbjct: 663 CLTNGTCCEKYCGCPK--MCKNR---FRGCHCAKSQCRSRQCPCFAAD---RECDPDVCR 714 Query: 475 RFNAVCGFG 501 CG G Sbjct: 715 NCWVGCGDG 723 >05_03_0362 - 12973488-12974251,12975346-12975580,12976410-12976738, 12977277-12977404,12977695-12977879,12977972-12978165, 12978239-12978368,12978507-12978566,12979037-12979059, 12979158-12979218,12979677-12979748,12979804-12979924, 12980351-12980415,12980973-12981089,12981970-12982239 Length = 917 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = -3 Query: 599 ITRQLLVRMSV*ISVQSAHCAVASPTGITNDFCPKPQTALNRLQ*LGSHRFTSESGSK 426 I +QLL M V IS+ V++ +D C + T+L+ + ++ +S+S SK Sbjct: 465 IVQQLLTSMGVGISMHLLEAIVSNSVADLDDSCGQDMTSLSTKPTIATNESSSKSYSK 522 >05_03_0170 - 9132207-9133010,9133232-9133894 Length = 488 Score = 28.7 bits (61), Expect = 5.6 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = +2 Query: 38 RSPAARERRCM----PKSTSPYYECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSCR 199 R P RRC+ PKST+ + S W G CVD D+C ++R D + R Sbjct: 210 RGPPRPLRRCIQGLDPKSTADLF------SSAAWVGERCVDGDDCFVLRVDADHAALR 261 >04_03_0588 + 17595299-17596151,17597519-17597665,17598562-17598837, 17599108-17599805 Length = 657 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/57 (26%), Positives = 26/57 (45%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 G++G + + C D++EC D + G+ C+N G + C G + PC Sbjct: 270 GFQGNPYNKGLDSCQDINECDDPKKYPCYGK-CINKLGGFDCFCPAGMRGNASVGPC 325 >04_03_0184 + 12395349-12395542,12396821-12397467,12398119-12398655, 12399087-12399239,12399315-12399809,12400032-12400555 Length = 849 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPC 390 GN C DVDEC +G +C N GSY C+ C Sbjct: 450 GNPYDANGCEDVDECKK-TPGIFKG-ICHNNIGSYQCMEC 487 >03_02_0580 + 9615646-9616647 Length = 333 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 9/54 (16%) Frame = -2 Query: 318 SALVHIHAMFPSSL-IASAPPARLPVN--------PGGHGPQVKPPSSLRHETR 184 S VH+H + + ++S+PPA V+ PGG+ Q KPP+ + + R Sbjct: 138 STNVHLHLLVEDEIRMSSSPPALPAVDQKEKTWFPPGGYNEQCKPPARITYADR 191 >02_05_1153 - 34501778-34502961,34503052-34503219,34503306-34504263 Length = 769 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 GN C D+DEC + G+ C NT GSY C Sbjct: 310 GNPYLDGGCKDIDECQRTKEYPCFGK-CTNTIGSYTC 345 >11_08_0003 + 27492503-27492812,27492863-27493148,27495399-27495652, 27496645-27496830,27497042-27498117 Length = 703 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = +2 Query: 65 CMPKSTSPYYECEGCPSGYQWNGYT-----CVDMDECDL 166 C ++ Y C+ C GY N Y C+D+DEC L Sbjct: 253 CNNRNNGEGYICK-CSEGYDGNPYLKGNGGCIDIDECHL 290 >05_06_0057 + 25253497-25253589,25253722-25253799,25254583-25254621, 25254724-25255263,25255352-25255450,25255614-25255691, 25255961-25256146,25256240-25256365 Length = 412 Score = 27.9 bits (59), Expect = 9.7 Identities = 23/74 (31%), Positives = 27/74 (36%) Frame = -2 Query: 336 TVGSSVSALVHIHAMFPSSLIASAPPARLPVNPGGHGPQVKPPSSLRHETRSSQGRIKSH 157 T SSV V H+ FP + S+ P P GP P SSL S+ Sbjct: 85 TPSSSVKPTVQDHSSFPQPQLPSSQQNIQPSGPFSSGPS-NPASSLDLPAMSA----NPQ 139 Query: 156 SSISTHVYPFHW*P 115 S YP H P Sbjct: 140 QSAQAKGYPIHQMP 153 >05_03_0491 + 14682895-14683365,14684127-14684656,14684739-14685213 Length = 491 Score = 27.9 bits (59), Expect = 9.7 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -2 Query: 270 SAPPARLPVNPGGHGPQVKPPSSLRHETRSSQGRIKSHSSISTHVYPFHW*PLG 109 S+PPARL VNP H R+ S HVYP W P G Sbjct: 292 SSPPARLRVNPNADVALAGADFVRNH-------RVLGVDFASVHVYPDTWLPAG 338 >04_04_0176 - 23329589-23331043 Length = 484 Score = 27.9 bits (59), Expect = 9.7 Identities = 22/58 (37%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = -2 Query: 270 SAPPARLPVNPGGHG--PQVKPPSSLRHETRSSQGRIKSHSSISTHVYPFHW*PLGHP 103 S PP LP+ GG G P V P + R R GR H ST PLG P Sbjct: 200 SCPPTLLPLGGGGGGDDPHVHAPRAARGRGR---GRGGGHGGNSTTARGNVGPPLGDP 254 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,649,673 Number of Sequences: 37544 Number of extensions: 546388 Number of successful extensions: 2152 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 2019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2135 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2127163404 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -