BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30389 (790 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6892| Best HMM Match : TSP_3 (HMM E-Value=2.94273e-44) 86 3e-17 SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) 62 7e-10 SB_2169| Best HMM Match : EGF_CA (HMM E-Value=6.4e-33) 60 3e-09 SB_26085| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8580| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_21661| Best HMM Match : EGF_CA (HMM E-Value=0) 50 2e-06 SB_58882| Best HMM Match : EGF_CA (HMM E-Value=0) 50 2e-06 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 50 3e-06 SB_33986| Best HMM Match : EGF_CA (HMM E-Value=3.5e-17) 50 3e-06 SB_4999| Best HMM Match : EGF_CA (HMM E-Value=0) 50 3e-06 SB_48384| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_33722| Best HMM Match : EGF_CA (HMM E-Value=0) 49 5e-06 SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_48923| Best HMM Match : EGF_CA (HMM E-Value=3.2e-27) 48 1e-05 SB_57139| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50806| Best HMM Match : EGF_CA (HMM E-Value=1e-27) 47 2e-05 SB_47176| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_15410| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_43576| Best HMM Match : EGF_CA (HMM E-Value=2.7e-38) 46 3e-05 SB_7289| Best HMM Match : EGF_CA (HMM E-Value=0) 46 5e-05 SB_48850| Best HMM Match : EGF_CA (HMM E-Value=2.1e-27) 46 5e-05 SB_5527| Best HMM Match : EGF_CA (HMM E-Value=1e-26) 45 6e-05 SB_2182| Best HMM Match : EGF_CA (HMM E-Value=0) 45 6e-05 SB_58993| Best HMM Match : EGF_CA (HMM E-Value=0) 45 8e-05 SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) 45 8e-05 SB_23501| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_17530| Best HMM Match : EGF_CA (HMM E-Value=0) 45 8e-05 SB_43077| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5780| Best HMM Match : EGF_CA (HMM E-Value=0) 44 1e-04 SB_3108| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52309| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41134| Best HMM Match : EGF_CA (HMM E-Value=0) 44 2e-04 SB_50721| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18560| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45154| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) 42 4e-04 SB_38935| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_35900| Best HMM Match : EGF_CA (HMM E-Value=2.5e-38) 42 4e-04 SB_4874| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) 42 4e-04 SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) 42 6e-04 SB_18281| Best HMM Match : EGF_CA (HMM E-Value=5.9e-11) 42 6e-04 SB_57080| Best HMM Match : EGF_CA (HMM E-Value=1.4013e-43) 42 6e-04 SB_25669| Best HMM Match : LRR_1 (HMM E-Value=9.1e-33) 42 6e-04 SB_6742| Best HMM Match : EGF_CA (HMM E-Value=5.40004e-41) 42 6e-04 SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_38887| Best HMM Match : EGF_CA (HMM E-Value=6.2e-31) 42 8e-04 SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21285| Best HMM Match : EGF_CA (HMM E-Value=1.3e-37) 41 0.001 SB_39808| Best HMM Match : EGF_CA (HMM E-Value=6.3e-35) 41 0.001 SB_28600| Best HMM Match : EGF_CA (HMM E-Value=4.2e-40) 41 0.001 SB_13123| Best HMM Match : EGF_CA (HMM E-Value=4.9e-22) 41 0.001 SB_19665| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_13199| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47465| Best HMM Match : EGF_CA (HMM E-Value=2.4e-08) 40 0.002 SB_5000| Best HMM Match : EGF_CA (HMM E-Value=0) 40 0.002 SB_37317| Best HMM Match : EGF_CA (HMM E-Value=6.6e-25) 40 0.002 SB_55657| Best HMM Match : EGF_CA (HMM E-Value=0) 40 0.002 SB_46351| Best HMM Match : EGF_CA (HMM E-Value=2.3e-14) 40 0.002 SB_7361| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55950| Best HMM Match : EGF_CA (HMM E-Value=2.7e-08) 40 0.003 SB_34822| Best HMM Match : EGF_CA (HMM E-Value=8.9e-09) 40 0.003 SB_44376| Best HMM Match : EGF_CA (HMM E-Value=7.8e-22) 39 0.004 SB_24529| Best HMM Match : Lectin_C (HMM E-Value=3.4e-27) 39 0.004 SB_55021| Best HMM Match : EGF_CA (HMM E-Value=1.4013e-45) 39 0.004 SB_26480| Best HMM Match : EGF (HMM E-Value=0) 39 0.004 SB_19340| Best HMM Match : EGF_CA (HMM E-Value=3.8e-27) 39 0.004 SB_15408| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_41711| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_58994| Best HMM Match : EGF_CA (HMM E-Value=2.3e-29) 38 0.007 SB_45954| Best HMM Match : VWA (HMM E-Value=4e-26) 38 0.007 SB_20531| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_18415| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_45136| Best HMM Match : EGF_CA (HMM E-Value=8.7e-36) 38 0.007 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 38 0.007 SB_13997| Best HMM Match : EGF_CA (HMM E-Value=1.2e-05) 38 0.007 SB_32816| Best HMM Match : EGF_CA (HMM E-Value=3.1e-11) 38 0.009 SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) 38 0.009 SB_15082| Best HMM Match : EGF_CA (HMM E-Value=5.5e-12) 38 0.009 SB_11375| Best HMM Match : EGF_CA (HMM E-Value=0) 38 0.009 SB_5376| Best HMM Match : EGF_CA (HMM E-Value=0) 38 0.009 SB_34419| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_14925| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_9772| Best HMM Match : EGF_CA (HMM E-Value=3.9e-25) 37 0.016 SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_54230| Best HMM Match : EGF (HMM E-Value=0) 37 0.021 SB_38403| Best HMM Match : PP2C (HMM E-Value=8.5e-35) 36 0.028 SB_23241| Best HMM Match : EGF_CA (HMM E-Value=6.3e-30) 36 0.028 SB_52863| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_13309| Best HMM Match : EGF (HMM E-Value=0) 36 0.037 SB_22873| Best HMM Match : EGF_CA (HMM E-Value=1.2e-14) 36 0.037 SB_20425| Best HMM Match : EGF_CA (HMM E-Value=1.2e-20) 36 0.037 SB_48275| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_47055| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_30640| Best HMM Match : EGF_CA (HMM E-Value=2.4e-09) 36 0.049 SB_12801| Best HMM Match : TSP_3 (HMM E-Value=2.3e-39) 36 0.049 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 35 0.065 SB_32940| Best HMM Match : EGF (HMM E-Value=0) 35 0.065 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.086 SB_8425| Best HMM Match : EGF (HMM E-Value=0) 35 0.086 SB_56285| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 34 0.11 SB_35208| Best HMM Match : EGF_CA (HMM E-Value=1.2e-09) 34 0.11 SB_27178| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_56885| Best HMM Match : EGF_CA (HMM E-Value=1.1e-08) 34 0.15 SB_48962| Best HMM Match : Cadherin (HMM E-Value=0) 34 0.15 SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) 33 0.20 SB_29649| Best HMM Match : Sushi (HMM E-Value=4.1e-18) 33 0.20 SB_18414| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_16758| Best HMM Match : EGF_CA (HMM E-Value=5.5e-14) 33 0.20 SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_673| Best HMM Match : VWA (HMM E-Value=8.9e-25) 33 0.26 SB_52794| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_27269| Best HMM Match : EGF_CA (HMM E-Value=9.6e-10) 33 0.26 SB_42336| Best HMM Match : Sushi (HMM E-Value=1.5e-08) 33 0.35 SB_42051| Best HMM Match : EGF_CA (HMM E-Value=6.9e-35) 33 0.35 SB_16935| Best HMM Match : Cadherin (HMM E-Value=0) 33 0.35 SB_31737| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) 32 0.46 SB_17803| Best HMM Match : SRCR (HMM E-Value=0) 32 0.46 SB_2661| Best HMM Match : EGF_CA (HMM E-Value=0.0062) 32 0.46 SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_34004| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_20112| Best HMM Match : EGF (HMM E-Value=0) 32 0.61 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 32 0.61 SB_54839| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_58558| Best HMM Match : EGF (HMM E-Value=0) 31 0.80 SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_12832| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_8569| Best HMM Match : EGF_CA (HMM E-Value=7.4e-06) 31 0.80 SB_20014| Best HMM Match : EGF_CA (HMM E-Value=1.6e-18) 31 0.80 SB_52861| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_46694| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 31 1.1 SB_57511| Best HMM Match : EGF_CA (HMM E-Value=0) 31 1.1 SB_45116| Best HMM Match : EGF (HMM E-Value=0) 31 1.1 SB_40116| Best HMM Match : EGF (HMM E-Value=0) 31 1.4 SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_23022| Best HMM Match : CUB (HMM E-Value=0) 31 1.4 SB_21597| Best HMM Match : ig (HMM E-Value=2.9e-14) 31 1.4 SB_7343| Best HMM Match : EGF (HMM E-Value=0) 31 1.4 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 30 1.9 SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) 30 1.9 SB_10743| Best HMM Match : ABC_membrane (HMM E-Value=0.23) 30 1.9 SB_52147| Best HMM Match : EGF (HMM E-Value=0) 30 1.9 SB_51220| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_50933| Best HMM Match : Laminin_EGF (HMM E-Value=0.0069) 30 2.5 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) 30 2.5 SB_3454| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_57514| Best HMM Match : EGF_CA (HMM E-Value=2.4e-20) 30 2.5 SB_21404| Best HMM Match : VWA (HMM E-Value=8.1e-27) 30 2.5 SB_4238| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 29 3.2 SB_38040| Best HMM Match : F5_F8_type_C (HMM E-Value=8.4e-30) 29 3.2 SB_16910| Best HMM Match : EGF (HMM E-Value=0) 29 3.2 SB_34550| Best HMM Match : VWA (HMM E-Value=0) 29 3.2 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_14708| Best HMM Match : IF-2B (HMM E-Value=0) 29 3.2 SB_12383| Best HMM Match : EGF_CA (HMM E-Value=2.5e-12) 29 3.2 SB_1891| Best HMM Match : EGF (HMM E-Value=6.5e-15) 29 3.2 SB_58789| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_30534| Best HMM Match : EGF (HMM E-Value=0.12) 29 4.3 SB_12758| Best HMM Match : EGF (HMM E-Value=2.5e-15) 29 4.3 SB_58268| Best HMM Match : Extensin_2 (HMM E-Value=0.002) 29 4.3 SB_42694| Best HMM Match : EGF_CA (HMM E-Value=1.2e-08) 29 4.3 SB_44694| Best HMM Match : EGF_CA (HMM E-Value=0.00091) 29 5.7 SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 29 5.7 SB_25563| Best HMM Match : HEAT (HMM E-Value=2.5e-20) 29 5.7 SB_27599| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_9722| Best HMM Match : EGF_CA (HMM E-Value=2.4e-06) 29 5.7 SB_2045| Best HMM Match : EGF (HMM E-Value=0) 29 5.7 SB_42355| Best HMM Match : EGF (HMM E-Value=2.9e-05) 28 7.5 SB_32719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_30861| Best HMM Match : Peptidase_A17 (HMM E-Value=2.1e-40) 28 7.5 SB_22289| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_8486| Best HMM Match : Granulin (HMM E-Value=0) 28 7.5 SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10) 28 9.9 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_39510| Best HMM Match : VWA (HMM E-Value=0) 28 9.9 SB_35462| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 28 9.9 SB_30275| Best HMM Match : EGF_CA (HMM E-Value=1.3e-13) 28 9.9 SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_40674| Best HMM Match : Extensin_2 (HMM E-Value=0.19) 28 9.9 SB_40416| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_32040| Best HMM Match : zf-CCHC (HMM E-Value=0.01) 28 9.9 SB_5393| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 28 9.9 >SB_6892| Best HMM Match : TSP_3 (HMM E-Value=2.94273e-44) Length = 749 Score = 86.2 bits (204), Expect = 3e-17 Identities = 38/85 (44%), Positives = 46/85 (54%) Frame = +3 Query: 513 CNTGWTGNGTVCGLDRDLDGHPDEQLPCNEPRCKKDNCPDVSNSGQEXXXXXXXXXXXXX 692 C G+TGNG CG D DLDG PD++LPC E C+ DNCP NSGQE Sbjct: 322 CKLGFTGNGIECGQDEDLDGFPDKKLPCYEASCQGDNCPLTPNSGQEDTDSDGVGDACDD 381 Query: 693 XXXXXXIPNFPDNCPLTPNPDQLAT 767 + + DNCPL NP+Q+ T Sbjct: 382 DDDNDGVRDIRDNCPLISNPEQMDT 406 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +3 Query: 618 DNCPDVSNSGQEXXXXXXXXXXXXXXXXXXXIPNFPDNCPLTPNPDQL 761 DNCP V N Q I DNCP+ NP+QL Sbjct: 416 DNCPRVWNKRQRDANGDGRGDACTADPDDDGIEGSHDNCPMHYNPEQL 463 Score = 29.1 bits (62), Expect = 4.3 Identities = 22/72 (30%), Positives = 27/72 (37%) Frame = +3 Query: 552 LDRDLDGHPDEQLPCNEPRCKKDNCPDVSNSGQEXXXXXXXXXXXXXXXXXXXIPNFPDN 731 LDRD DG D C DNCP V N+ + + + DN Sbjct: 463 LDRDRDGFGDT--------C--DNCPAVPNNQSDTNQNLIGDACEGVDSDHDGVIDRADN 512 Query: 732 CPLTPNPDQLAT 767 C PN DQ+ T Sbjct: 513 CVSVPNADQVDT 524 >SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) Length = 2996 Score = 61.7 bits (143), Expect = 7e-10 Identities = 26/50 (52%), Positives = 30/50 (60%) Frame = +3 Query: 504 KVVCNTGWTGNGTVCGLDRDLDGHPDEQLPCNEPRCKKDNCPDVSNSGQE 653 K VC G+ GNG C D+D D PD L C C+KDNCP V N+GQE Sbjct: 1794 KCVCKNGFGGNGEECNPDQDFDAIPDVGLSCTLSNCRKDNCPVVPNTGQE 1843 Score = 52.8 bits (121), Expect = 3e-07 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = +2 Query: 56 ERRCMP-----KSTSPYYECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSCRN 202 E+ C P + S ++CE CP GY+ +G TC D++EC L PC D SC N Sbjct: 1635 EQACFPGVKCRNTGSGSFKCESCPDGYEGDGVTCTDINECSLAYPCYDNSSCVN 1688 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +1 Query: 286 REHCVDVDECADGRANCPRGRLCVNTP-GSYICVPCGGHYYVNTTRPCFDPD 438 ++ C +++ECA+G A+C C+NTP GSY C C + + T C D Sbjct: 1719 KQVCTEINECAEGTASCDPNSQCLNTPLGSYTCGFCNPGFIGHGTTGCSPGD 1770 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 83 SPYYECEGCPSGYQWNGYTCVDMDECDLIRP-CDDLVSC 196 SP Y C GCP GY+ N + + + + C ++ C Sbjct: 1690 SPGYRCGGCPPGYRGNAPSGIGLSHAHSSKQVCTEINEC 1728 >SB_2169| Best HMM Match : EGF_CA (HMM E-Value=6.4e-33) Length = 133 Score = 59.7 bits (138), Expect = 3e-09 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCG 393 G E + CVDVDEC+ G A CP G+ CVNT GSY C+P G Sbjct: 37 GYEPQNGRCVDVDECSSGLARCPSGQSCVNTEGSYSCLPIG 77 Score = 48.0 bits (109), Expect = 9e-06 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPC-GGHYYVN 411 G E R C D+DECA G A C R + C N G+Y CV C G+ + N Sbjct: 81 GFEFRGGKCQDIDECASGIARCGREQFCENVEGAYRCVTCRTGYRFTN 128 Score = 31.5 bits (68), Expect = 0.80 Identities = 21/66 (31%), Positives = 27/66 (40%), Gaps = 5/66 (7%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEG----CPSGYQWNGYTCVDMDECDL-IRPCDDLV 190 C P A ++ C S Y C+ C GY+ CVD+DEC + C Sbjct: 5 CTEGSYPCAADQTCQNVFGS--YRCQASAIKCSRGYEPQNGRCVDVDECSSGLARCPSGQ 62 Query: 191 SCRNEE 208 SC N E Sbjct: 63 SCVNTE 68 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYIC----VPCGGHYYVNTTRPCFDPD 438 +DEC +G C + C N GSY C + C Y R C D D Sbjct: 2 IDECTEGSYPCAADQTCQNVFGSYRCQASAIKCSRGYEPQNGR-CVDVD 49 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +2 Query: 77 STSPYYECE--GCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRNEE 208 +T Y C GC G+++ G C D+DEC I C C N E Sbjct: 66 NTEGSYSCLPIGCSPGFEFRGGKCQDIDECASGIARCGREQFCENVE 112 >SB_26085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 484 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/45 (57%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +1 Query: 286 REHCVDVDECADGRANCPRGRLCVNTPGSYICVPCG-GHYYVNTT 417 + HC+DVDECA G A CP G CVNT GS+ C CG G++ VN T Sbjct: 321 KAHCIDVDECALG-ATCPSGTNCVNTQGSFYC-DCGHGYHAVNGT 363 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 4/61 (6%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKR---CDP-SY 468 D+DECA G C + C NT GSY+C+ G ++N C D + ++ CD +Y Sbjct: 399 DLDECATGVYQCDQHAFCFNTIGSYMCLCKPG--FINNENACLDRNECLEEENDCDDNAY 456 Query: 469 C 471 C Sbjct: 457 C 457 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +1 Query: 301 DVDECA-DGRANCPRGRLCVNTPGSYICVPCG 393 ++DEC G CP CVNT GSY C G Sbjct: 197 NIDECEIAGPIICPENTNCVNTHGSYECTCLG 228 Score = 31.9 bits (69), Expect = 0.61 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C+D +EC + +C C NT GSY C Sbjct: 438 CLDRNECLEEENDCDDNAYCDNTSGSYEC 466 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/75 (34%), Positives = 33/75 (44%), Gaps = 5/75 (6%) Frame = +1 Query: 289 EHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT----RPCFDPDS-LVKR 453 + C D +ECA NC G C+N GSY C C + ++ T C D D LV Sbjct: 236 DKCRDRNECA--YKNCGVGATCLNALGSYAC-QCEPGFRLDRTLGLSGVCVDMDECLVPG 292 Query: 454 CDPSYCRRFNAVCGF 498 P + N V GF Sbjct: 293 SCPEHSVCTNHVKGF 307 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 CVD+DEC +CP +C N + C G+ + C D D Sbjct: 282 CVDMDECLVP-GSCPEHSVCTNHVKGFTCECESGYLMDDLKAHCIDVD 328 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 5/73 (6%) Frame = +2 Query: 5 TVGSASTCVTLRS---PAARERRCMPKSTSPYYECEGCPSGYQWNGYT--CVDMDECDLI 169 T+G + CV + P + + + + CE C SGY + C+D+DEC L Sbjct: 275 TLGLSGVCVDMDECLVPGSCPEHSVCTNHVKGFTCE-CESGYLMDDLKAHCIDVDECALG 333 Query: 170 RPCDDLVSCRNEE 208 C +C N + Sbjct: 334 ATCPSGTNCVNTQ 346 >SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 52.0 bits (119), Expect = 5e-07 Identities = 30/73 (41%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C NT GSY C+ C +Y N+TR C D Sbjct: 550 PGFSGNGRE-----CTDIDECGTGDHTCDKNARCNNTIGSYDCM-CMSGFYGNSTR-CRD 602 Query: 433 PDSLVK---RCDP 462 D K C P Sbjct: 603 IDECKKEKHHCSP 615 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/65 (38%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C NT GSY C G + R C D Sbjct: 427 PGFSGDGRE-----CTDIDECVTGDHTCDKNARCNNTIGSYHCTCNPG--FSGDGRECTD 479 Query: 433 PDSLV 447 D V Sbjct: 480 MDECV 484 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/65 (38%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C NT GSY C G + R C D Sbjct: 345 PGFSGDGRE-----CTDIDECVTGDHTCDKNARCNNTIGSYHCTCNPG--FSGDGRECTD 397 Query: 433 PDSLV 447 D V Sbjct: 398 IDECV 402 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/65 (38%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C NT GSY C G + R C D Sbjct: 386 PGFSGDGRE-----CTDIDECVTGDHTCDKNARCNNTIGSYHCRCNPG--FSGDGRECTD 438 Query: 433 PDSLV 447 D V Sbjct: 439 IDECV 443 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/65 (36%), Positives = 28/65 (43%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C N GSY C G + R C D Sbjct: 304 PGFSGDGRE-----CTDIDECVTGDHTCDKNAKCNNIIGSYHCTCNPG--FSGDGRECTD 356 Query: 433 PDSLV 447 D V Sbjct: 357 IDECV 361 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/65 (35%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C N GSY C+ G + R C D Sbjct: 140 PGFSGDGR-----NCTDIDECVTGNHTCDKNAKCNNIIGSYHCMCNPG--FSKDGRECTD 192 Query: 433 PDSLV 447 D V Sbjct: 193 IDECV 197 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/65 (35%), Positives = 31/65 (47%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G ++C D+DEC G C + C NT GS+ C+ G + R C D Sbjct: 263 PGFSGDG-----KNCTDIDECVTGDHTCDKNAKCNNTIGSHHCMCNPG--FSGDGRECTD 315 Query: 433 PDSLV 447 D V Sbjct: 316 IDECV 320 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/62 (37%), Positives = 29/62 (46%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C+D+DEC G C + C N GS+ C C + N R C D Sbjct: 509 PGFSGDGRE-----CIDIDECVTGDHTCDKNAKCNNIVGSHHCT-CNPGFSGN-GRECTD 561 Query: 433 PD 438 D Sbjct: 562 ID 563 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/65 (35%), Positives = 28/65 (43%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C N GS+ C G + R C D Sbjct: 468 PGFSGDGRE-----CTDMDECVTGDHTCDKNAKCNNIIGSHHCTCNPG--FSGDGRECID 520 Query: 433 PDSLV 447 D V Sbjct: 521 IDECV 525 Score = 38.7 bits (86), Expect = 0.005 Identities = 28/81 (34%), Positives = 34/81 (41%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G E C D+DEC G C + C N GSY C+ G + R C D Sbjct: 181 PGFSKDGRE-----CTDIDECVTGDHTCDKNARCNNIIGSYHCMCNPG--FSGDGRNCTD 233 Query: 433 PDSLVKRCDPSYCRRFNAVCG 495 D V C + NA CG Sbjct: 234 IDECV--TGDHTCDK-NARCG 251 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C N GS+ C+ G + + C D Sbjct: 222 PGFSGDGR-----NCTDIDECVTGDHTCDKNARCGNIIGSHHCICNPG--FSGDGKNCTD 274 Query: 433 PDSLV 447 D V Sbjct: 275 IDECV 279 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/51 (37%), Positives = 23/51 (45%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLV 447 C + DEC+ G C + C NT GSY C G + R C D D V Sbjct: 108 CSETDECSAGNHTCDKNAKCNNTIGSYHCTCNPG--FSGDGRNCTDIDECV 156 Score = 35.5 bits (78), Expect = 0.049 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + RC +T Y C C G+ +G C DMDEC CD C N Sbjct: 442 CVTGDHTCDKNARC--NNTIGSYHCT-CNPGFSGDGRECTDMDECVTGDHTCDKNAKCNN 498 Score = 33.9 bits (74), Expect = 0.15 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + RC +T Y C C G+ +G C D+DEC CD C N Sbjct: 401 CVTGDHTCDKNARC--NNTIGSYHCR-CNPGFSGDGRECTDIDECVTGDHTCDKNARCNN 457 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + RC +T Y C C G+ +G C D+DEC CD C N Sbjct: 360 CVTGDHTCDKNARC--NNTIGSYHCT-CNPGFSGDGRECTDIDECVTGDHTCDKNARCNN 416 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 GN R C D+DEC + +C +C NT GS+ C Sbjct: 595 GNSTR---CRDIDECKKEKHHCSPHAICYNTLGSFKC 628 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 C G+ NG C D+DEC CD C N Sbjct: 548 CNPGFSGNGRECTDIDECGTGDHTCDKNARCNN 580 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 Y C C G+ +G C D+DEC CD C N Sbjct: 134 YHCT-CNPGFSGDGRNCTDIDECVTGNHTCDKNAKCNN 170 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/60 (31%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + RC + Y C C G+ +G C D+DEC CD C N Sbjct: 196 CVTGDHTCDKNARC--NNIIGSYHCM-CNPGFSGDGRNCTDIDECVTGDHTCDKNARCGN 252 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T + C C G+ +G C D+DEC CD C N Sbjct: 278 CVTGDHTCDKNAKC--NNTIGSHHCM-CNPGFSGDGRECTDIDECVTGDHTCDKNAKCNN 334 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C + Y C C G+ +G C D+DEC CD C N Sbjct: 155 CVTGNHTCDKNAKC--NNIIGSYHCM-CNPGFSKDGRECTDIDECVTGDHTCDKNARCNN 211 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C + Y C C G+ +G C D+DEC CD C N Sbjct: 319 CVTGDHTCDKNAKC--NNIIGSYHCT-CNPGFSGDGRECTDIDECVTGDHTCDKNARCNN 375 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 C G+ +G C+D+DEC CD C N Sbjct: 507 CNPGFSGDGRECIDIDECVTGDHTCDKNAKCNN 539 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 C G+ +G C D+DEC CD C N Sbjct: 261 CNPGFSGDGKNCTDIDECVTGDHTCDKNAKCNN 293 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDEC 160 C T + RC +T Y+C C SG+ N C D+DEC Sbjct: 565 CGTGDHTCDKNARC--NNTIGSYDCM-CMSGFYGNSTRCRDIDEC 606 >SB_8580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 51.2 bits (117), Expect = 9e-07 Identities = 25/48 (52%), Positives = 27/48 (56%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C D+DECA G ANCP CVN GSY C G+ VN T C D D Sbjct: 243 CEDIDECALGVANCPASADCVNNNGSYTCRCKPGYTLVNNT--CIDTD 288 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/48 (50%), Positives = 26/48 (54%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C+D DECA G A CP CVN GSY C G+ VN T C D D Sbjct: 284 CIDTDECALGVATCPASADCVNNDGSYTCRCKRGYTLVNKT--CKDID 329 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/59 (45%), Positives = 29/59 (49%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYC 471 C D+DECA G A CP CVN GSY C G VN T C P SL + S C Sbjct: 325 CKDIDECALGVATCPASADCVNNNGSYTCRCKRGFTLVNNT--CKVPLSLQRPLMMSLC 381 Score = 45.6 bits (103), Expect = 5e-05 Identities = 24/58 (41%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSL-VKRCDPS 465 C D+DEC + CP R CVN GSY C G+ VN T D +L V C S Sbjct: 202 CDDIDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLVNNTCEDIDECALGVANCPAS 259 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 D+DECA G A CP CVN GSY C G+ VN T Sbjct: 58 DIDECALGVATCPASADCVNNDGSYTCRCKRGYTLVNKT 96 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 D+DECA G A CP CVN GSY C G+ VN T Sbjct: 385 DIDECALGVATCPASADCVNNDGSYTCRCKRGYTLVNKT 423 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRNEE 208 Y C C GY TC+D DEC L + C C N + Sbjct: 269 YTCR-CKPGYTLVNNTCIDTDECALGVATCPASADCVNND 307 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = +2 Query: 41 SPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 S R C+ S Y C+ C GY TC D+DEC L + C C N Sbjct: 213 STCPANRYCVNNDGS--YTCK-CKPGYTLVNNTCEDIDECALGVANCPASADCVN 264 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 Y C C GY TC D+DEC L + C C N Sbjct: 310 YTCR-CKRGYTLVNKTCKDIDECALGVATCPASADCVN 346 >SB_21661| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1202 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/49 (51%), Positives = 27/49 (55%) Frame = +1 Query: 292 HCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 +C D+DECA G C LC NT GSY C C YY N R CFD D Sbjct: 994 NCTDMDECALGIDTCHSDALCTNTKGSYTCA-CKQGYYGNGFR-CFDTD 1040 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 5/68 (7%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH----YYVNTTRPCFDPDSLVKRCDP 462 C D+DECA G NC + C+NT G++ C G+ Y + C D C P Sbjct: 1077 CKDIDECALGIHNCSKDAACINTKGNFYCTCLPGYNGTGYVCSDINECLDGS---HNCHP 1133 Query: 463 -SYCRRFN 483 + C FN Sbjct: 1134 NAECFNFN 1141 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYY 405 G++G G +CVD+DEC G C +CVN+ G ++C G Y Sbjct: 1151 GYKGNGT-----YCVDIDECRAGTHGCQGLSVCVNSIGGFVCTCDPGFRY 1195 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/62 (38%), Positives = 29/62 (46%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ GTG C D++EC DG NC C N G++ C C Y N T C D Sbjct: 1109 PGYNGTGYV-----CSDINECLDGSHNCHPNAECFNFNGTFQC-NCSRGYKGNGTY-CVD 1161 Query: 433 PD 438 D Sbjct: 1162 ID 1163 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 CVD+DECA NC C NT GS+ C Sbjct: 49 CVDIDECAIYTDNCHSDANCTNTKGSFYC 77 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 C D DEC NC LC NT GSY C G+ Sbjct: 1036 CFDTDECTYDLDNCHADALCTNTKGSYNCTCLRGY 1070 Score = 37.5 bits (83), Expect = 0.012 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 CVD++EC NC C NT GS+ C Sbjct: 904 CVDINECTSNTHNCDSNANCTNTKGSFYC 932 Score = 36.7 bits (81), Expect = 0.021 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 +T Y C C GY +G+TC D+DEC L I C +C N Sbjct: 1057 NTKGSYNCT-CLRGYSGDGFTCKDIDECALGIHNCSKDAACIN 1098 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 +T+ Y C C GY +G C DMDEC L I C C N Sbjct: 975 NTNGSYYC-ACQVGYTGDGVNCTDMDECALGIDTCHSDALCTN 1016 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 ++C C GY+ NG CVD+DEC C L C N Sbjct: 1144 FQCN-CSRGYKGNGTYCVDIDECRAGTHGCQGLSVCVN 1180 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDEC 160 +T Y C C GY NG+ C D DEC Sbjct: 1016 NTKGSYTC-ACKQGYYGNGFRCFDTDEC 1042 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Frame = +2 Query: 11 GSASTCVTLRSPAARERRCMPKS----TSPYYECEGCPSGYQWNGYTCVDMDECD 163 G CV + + C + T + C C GY +G TCVD++ECD Sbjct: 899 GDGVKCVDINECTSNTHNCDSNANCTNTKGSFYCT-CHVGYSGDGVTCVDINECD 952 Score = 31.9 bits (69), Expect = 0.61 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GY NG TC+D+DEC Sbjct: 224 CHVGYSGNGVTCLDIDEC 241 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECD 163 C GY +G TC+D++ECD Sbjct: 842 CHVGYSGDGATCIDINECD 860 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 C GY +G CVD++EC CD +C N Sbjct: 893 CHVGYSGDGVKCVDINECTSNTHNCDSNANCTN 925 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDLIRP-CDDLVSCRN 202 C GY G CVD+DEC + C +C N Sbjct: 38 CQVGYSGYGVMCVDIDECAIYTDNCHSDANCTN 70 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C +GY +G TCVD+ EC Sbjct: 129 CHTGYSGDGVTCVDISEC 146 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GY +G TCVD++EC Sbjct: 79 CHVGYSGDGVTCVDINEC 96 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GY +G TCVD++EC Sbjct: 274 CHVGYSGDGVTCVDINEC 291 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GY +G TCVD++EC Sbjct: 468 CHVGYSGDGVTCVDINEC 485 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GY +G TCVD++EC Sbjct: 792 CHVGYSGDGVTCVDINEC 809 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 C GY GY C D++EC D C C N Sbjct: 1107 CLPGYNGTGYVCSDINECLDGSHNCHPNAECFN 1139 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 9/38 (23%) Frame = +1 Query: 295 CVDVDEC-----ADGRA----NCPRGRLCVNTPGSYIC 381 CVD++EC A A NC +C NT GSY C Sbjct: 945 CVDINECDNTTLAQHHAYYAHNCHGDGICYNTNGSYYC 982 >SB_58882| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1027 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/49 (51%), Positives = 27/49 (55%) Frame = +1 Query: 292 HCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 +C D+DECA G C LC NT GSY C C YY N R CFD D Sbjct: 408 NCTDMDECALGIDTCHSDALCTNTKGSYTCA-CKQGYYGNGFR-CFDTD 454 Score = 45.2 bits (102), Expect = 6e-05 Identities = 29/93 (31%), Positives = 41/93 (44%), Gaps = 9/93 (9%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 G++G G +CVD+DEC G C +CVN+ G ++C G Y + C+D Sbjct: 565 GYKGNGT-----YCVDIDECRAGTHGCQGLSVCVNSIGGFVCTCDPGFRYNGS--DCWDI 617 Query: 436 DSLVK---RCDPSY--CRR----FNAVCGFGQK 507 D V+ CD + C F C G K Sbjct: 618 DECVENTHNCDKKFGVCTNRAPFFKCACALGSK 650 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 5/68 (7%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH----YYVNTTRPCFDPDSLVKRCDP 462 C D+DECA G NC + C+NT G++ C G+ Y + C D C P Sbjct: 491 CKDIDECALGIHNCSKDAACINTKGNFYCTCLPGYNGTGYVCSDINECLDGS---HNCHP 547 Query: 463 -SYCRRFN 483 + C FN Sbjct: 548 NAECFNFN 555 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/62 (38%), Positives = 29/62 (46%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ GTG C D++EC DG NC C N G++ C C Y N T C D Sbjct: 523 PGYNGTGYV-----CSDINECLDGSHNCHPNAECFNFNGTFQC-NCSRGYKGNGTY-CVD 575 Query: 433 PD 438 D Sbjct: 576 ID 577 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 C D DEC NC LC NT GSY C G+ Sbjct: 450 CFDTDECTYDLDNCHADALCTNTKGSYNCTCLRGY 484 Score = 37.5 bits (83), Expect = 0.012 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 CVD++EC NC C NT GS+ C Sbjct: 318 CVDINECTSNTHNCDSNANCTNTKGSFYC 346 Score = 36.7 bits (81), Expect = 0.021 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 +T Y C C GY +G+TC D+DEC L I C +C N Sbjct: 471 NTKGSYNCT-CLRGYSGDGFTCKDIDECALGIHNCSKDAACIN 512 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 +T+ Y C C GY +G C DMDEC L I C C N Sbjct: 389 NTNGSYYC-ACQVGYTGDGVNCTDMDECALGIDTCHSDALCTN 430 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 ++C C GY+ NG CVD+DEC C L C N Sbjct: 558 FQCN-CSRGYKGNGTYCVDIDECRAGTHGCQGLSVCVN 594 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDEC 160 +T Y C C GY NG+ C D DEC Sbjct: 430 NTKGSYTC-ACKQGYYGNGFRCFDTDEC 456 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Frame = +2 Query: 11 GSASTCVTLRSPAARERRCMPKS----TSPYYECEGCPSGYQWNGYTCVDMDECD 163 G CV + + C + T + C C GY +G TCVD++ECD Sbjct: 313 GDGVKCVDINECTSNTHNCDSNANCTNTKGSFYCT-CHVGYSGDGVTCVDINECD 366 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECD 163 C GY +G TC+D++ECD Sbjct: 256 CHVGYSGDGATCIDINECD 274 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 C GY +G CVD++EC CD +C N Sbjct: 307 CHVGYSGDGVKCVDINECTSNTHNCDSNANCTN 339 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GY +G TCVD++EC Sbjct: 206 CHVGYSGDGVTCVDINEC 223 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 C GY GY C D++EC D C C N Sbjct: 521 CLPGYNGTGYVCSDINECLDGSHNCHPNAECFN 553 Score = 28.7 bits (61), Expect = 5.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C G+++NG C D+DEC Sbjct: 603 CDPGFRYNGSDCWDIDEC 620 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 9/38 (23%) Frame = +1 Query: 295 CVDVDEC-----ADGRA----NCPRGRLCVNTPGSYIC 381 CVD++EC A A NC +C NT GSY C Sbjct: 359 CVDINECDNTTLAQHHAYYAHNCHGDGICYNTNGSYYC 396 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 49.6 bits (113), Expect = 3e-06 Identities = 30/85 (35%), Positives = 37/85 (43%), Gaps = 2/85 (2%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICV--PCGGHYYVNTTRPC 426 PG+R + + R C+D DECA C R C NT GSY CV C +Y C Sbjct: 363 PGYRTSPDGRT---CMDDDECAGSDGVCQRDEQCFNTKGSYRCVQTSCPANYNQLGPGFC 419 Query: 427 FDPDSLVKRCDPSYCRRFNAVCGFG 501 P SL C P R + +G Sbjct: 420 VTPCSLQGYCTPQALRYYTTTLPYG 444 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = +1 Query: 286 REHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 R+ CVD+DEC+ + N + + C+NT G Y C G+ R C D D Sbjct: 329 RQSCVDIDECSSNQTNSCQYQ-CINTEGGYQCKCPPGYRTSPDGRTCMDDD 378 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWN--GYTCVDMDEC 160 +T Y+C+ CP GY+ + G TC+D DEC Sbjct: 352 NTEGGYQCK-CPPGYRTSPDGRTCMDDDEC 380 Score = 29.9 bits (64), Expect = 2.5 Identities = 23/69 (33%), Positives = 26/69 (37%), Gaps = 3/69 (4%) Frame = +1 Query: 274 NERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSL--- 444 N+ R D+DEC C G C NT GSY C C Y + C D D Sbjct: 203 NQSRYFRVSDIDECVG--VVCNHG--CRNTDGSYECY-CFSGYELIAGGQCRDIDECRVN 257 Query: 445 VKRCDPSYC 471 C P C Sbjct: 258 ASVCGPKQC 266 >SB_33986| Best HMM Match : EGF_CA (HMM E-Value=3.5e-17) Length = 85 Score = 49.6 bits (113), Expect = 3e-06 Identities = 24/51 (47%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC-VPCGGHY 402 PG+ +ER C D+DEC+ CP G+ CVNTPG+Y C PCG Y Sbjct: 28 PGFYLLDDERT---CEDLDECSLPSTKCPDGQRCVNTPGNYRCESPCGAGY 75 >SB_4999| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1054 Score = 49.6 bits (113), Expect = 3e-06 Identities = 25/48 (52%), Positives = 27/48 (56%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C D+DECA G ANCP CVN GSY C G+ VN T C D D Sbjct: 233 CEDIDECALGVANCPASADCVNNDGSYTCRCKPGYTLVNNT--CKDID 278 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/73 (38%), Positives = 34/73 (46%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCR 474 C D+DECA G A CP CVN GSY C C Y +N C D + + P C Sbjct: 99 CDDIDECALGVATCPASADCVNNDGSYTC-RCKRGYTLN-NNTCTDVNECTE--IPYVCS 154 Query: 475 RFNAVCGFGQKSF 513 N++C SF Sbjct: 155 GENSICENTDGSF 167 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 C D+DECA G A CP CVN GSY C G+ VN T Sbjct: 274 CKDIDECALGVATCPASADCVNNDGSYTCRCKRGYTLVNKT 314 Score = 45.2 bits (102), Expect = 6e-05 Identities = 22/48 (45%), Positives = 25/48 (52%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C D+DEC + CP R CVN GSY C G+ VN T C D D Sbjct: 420 CDDIDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLVNNT--CEDID 465 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D+DECA G A CP CVN GSY C Sbjct: 461 CEDIDECALGVATCPASADCVNNDGSYTC 489 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = +1 Query: 280 RRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 R C DV+ECA + C C NT GSY+C C Y Sbjct: 599 RNLTSCDDVNECARDPSPCHENAACTNTKGSYLC-RCNSGY 638 Score = 35.1 bits (77), Expect = 0.065 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 6/87 (6%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRAN-CP-RGRLCVNTPGSYIC-VPCGGHYYVNT---TRPCFD 432 G + C DV+EC D N C +G C+N PGS C P G + ++ T C D Sbjct: 494 GYTLKNNECEDVNECLDLFLNTCLFKGLDCINLPGSLQCKCPAGQKWDPDSFYGTGGCVD 553 Query: 433 PDSLVKRCDPSYCRRFNAVCGFGQKSF 513 + V+ P C N++C + SF Sbjct: 554 LNECVE--TPYVCSGDNSICQNTEGSF 578 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +2 Query: 41 SPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRNEE 208 S R C+ S Y C+ C GY TC D+DEC L + C C N + Sbjct: 431 STCPANRYCVNNDGS--YTCK-CKPGYTLVNNTCEDIDECALGVATCPASADCVNND 484 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRNEE 208 Y C+ C GY TC D+DEC L + C C N + Sbjct: 218 YTCK-CKPGYTLVNNTCEDIDECALGVANCPASADCVNND 256 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRNEE 208 Y C C GY TC D+DEC L + C C N + Sbjct: 259 YTCR-CKPGYTLVNNTCKDIDECALGVATCPASADCVNND 297 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDEC 160 Y C C GY N TC D++EC Sbjct: 125 YTCR-CKRGYTLNNNTCTDVNEC 146 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 346 RLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSL-VKRCDPS 465 R CVN GSY C G+ VN T D +L V C S Sbjct: 209 RYCVNNDGSYTCKCKPGYTLVNNTCEDIDECALGVANCPAS 249 >SB_48384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1678 Score = 48.8 bits (111), Expect = 5e-06 Identities = 28/73 (38%), Positives = 34/73 (46%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCR 474 C D+DEC G A CP CVN GSY C G+ VN T C D + + P C Sbjct: 930 CDDIDECGLGVATCPASADCVNNDGSYTCRCKRGYTLVNKT--CTDVNECTE--TPYVCS 985 Query: 475 RFNAVCGFGQKSF 513 N++C SF Sbjct: 986 GENSICENTDGSF 998 Score = 44.8 bits (101), Expect = 8e-05 Identities = 25/57 (43%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTR----PCFDPDSLVKR 453 C D+DECA G A CP CVN GSY C C Y +N P F S V R Sbjct: 1064 CEDIDECALGVATCPASADCVNNDGSYTC-RCKPGYELNNNECEAVPVFSDPSTVLR 1119 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/64 (34%), Positives = 30/64 (46%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRRF 480 D+DEC +CP C+NT GSY C C Y N + C D + + P C Sbjct: 785 DIDECRRNIYDCPADSQCINTYGSYKC-SCKRGYAHNDSNVCVDVNECTE--TPYVCSGN 841 Query: 481 NAVC 492 N++C Sbjct: 842 NSIC 845 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRNEE 208 Y C+ C GY TC D+DEC L + C C N + Sbjct: 1049 YTCK-CKPGYTLVNNTCEDIDECALGVATCPASADCVNND 1087 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +1 Query: 346 RLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 R CVN GSY C G+ VN T C D D Sbjct: 1040 RYCVNNDGSYTCKCKPGYTLVNNT--CEDID 1068 >SB_33722| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 124 Score = 48.8 bits (111), Expect = 5e-06 Identities = 26/58 (44%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSL-VKRCDPS 465 C D+DECA G A CP CVN GSY C G+ VN T D +L V C S Sbjct: 40 CTDIDECALGVATCPASADCVNNDGSYTCKCKPGYTLVNNTCEDIDECALGVANCPAS 97 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 C D+DECA G ANCP C N GSY C G+ VN T Sbjct: 81 CEDIDECALGVANCPASADCFNYDGSYTCRCKRGYTLVNKT 121 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/45 (48%), Positives = 24/45 (53%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 +DECA G ANCP C N GSY C G+ VN T C D D Sbjct: 2 IDECALGVANCPASADCFNYDGSYTCRCKRGYTLVNKT--CTDID 44 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRNEE 208 Y C C GY TC D+DEC L + C C N + Sbjct: 25 YTCR-CKRGYTLVNKTCTDIDECALGVATCPASADCVNND 63 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 Y C+ C GY TC D+DEC L + C C N Sbjct: 66 YTCK-CKPGYTLVNNTCEDIDECALGVANCPASADCFN 102 >SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5659 Score = 48.4 bits (110), Expect = 7e-06 Identities = 30/89 (33%), Positives = 38/89 (42%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCR 474 C DVDEC DG +C C NTPG+++C G Y R C D D C+ Sbjct: 415 CTDVDECTDGLHDCNVNAFCTNTPGTFVCRCIRG--YQGDGRTCADVDE---------CK 463 Query: 475 RFNAVCGFGQKSFVIPVGLATAQCADWTE 561 CG + +G T QCA+ E Sbjct: 464 TGQVKCGENEVC-ANSLGSFTCQCAEGYE 491 Score = 44.0 bits (99), Expect = 1e-04 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D+DEC G+ +C LC NT GSY+C Sbjct: 40 CTDIDECQAGKYSCDPNALCTNTEGSYVC 68 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 271 GNERRRE-HCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 G ER + C DV+EC G+ +C LC NT G++IC G Y+ + C D D Sbjct: 489 GYERDSQGKCADVNECKTGKHDCSVNALCTNTDGTFICRCLRG--YIGDGKTCIDFD 543 Score = 43.2 bits (97), Expect = 2e-04 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D+DEC+DG +C +C N PG+++C Sbjct: 661 CADIDECSDGSHDCHVNAICTNVPGTFLC 689 Score = 42.3 bits (95), Expect = 4e-04 Identities = 33/89 (37%), Positives = 39/89 (43%), Gaps = 1/89 (1%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRAN-CPRGRLCVNTPGSYICVPCGGHYYVNTTRPCF 429 PG+ G G + C DVDECA N C LC N+ GSY+C G Y C Sbjct: 242 PGFEGDGKQ-----CKDVDECASVLHNKCDPNALCTNSVGSYVCRCKKG--YTGDGITCK 294 Query: 430 DPDSLVKRCDPSYCRRFNAVCGFGQKSFV 516 D D + D C NA+C SFV Sbjct: 295 DIDECTNKTDD--CDA-NALCTNVLGSFV 320 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/66 (34%), Positives = 29/66 (43%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCR 474 C D +EC C LC NTPGSY+C G + + C D D D S+ Sbjct: 620 CKDKNECVGSDLLCDPNALCTNTPGSYLCRCKSG--FQGDGKTCADIDEC---SDGSHDC 674 Query: 475 RFNAVC 492 NA+C Sbjct: 675 HVNAIC 680 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/74 (35%), Positives = 33/74 (44%), Gaps = 3/74 (4%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVK---RCDPSYCR 474 +DECA NC LC NT GS++C G Y + C D D CDP Sbjct: 2 IDECASDTHNCHPNALCTNTDGSHVCRCVRG--YQGDGKTCTDIDECQAGKYSCDP---- 55 Query: 475 RFNAVCGFGQKSFV 516 NA+C + S+V Sbjct: 56 --NALCTNTEGSYV 67 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDS----LVKRCDP 462 CVD DEC + +C + C+N+ GSY C G + + C D D L +CDP Sbjct: 210 CVDKDECVEEDHDCAKSADCINSVGSYSCQCRPG--FEGDGKQCKDVDECASVLHNKCDP 267 Query: 463 S 465 + Sbjct: 268 N 268 Score = 38.7 bits (86), Expect = 0.005 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D++EC +G ANC C N+ GSY C Sbjct: 702 CADINECFEGTANCDINAECTNSVGSYNC 730 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPS 465 C+D DEC + +C C+N+ GSY C+ G + + C D + +CDP+ Sbjct: 539 CIDFDECKLPKNDCDVNAECINSIGSYSCICKPG--FTGNGKTCTDLGPV--KCDPT 591 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDLIR-PCDDLVSCRNEE 208 C GYQ +G TC D+DEC + CD C N E Sbjct: 29 CVRGYQGDGKTCTDIDECQAGKYSCDPNALCTNTE 63 Score = 36.3 bits (80), Expect = 0.028 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D+DEC + +C LC N GS++C Sbjct: 293 CKDIDECTNKTDDCDANALCTNVLGSFVC 321 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 98 CEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 CE C G+Q +G TC D+DEC D + C+ C N Sbjct: 402 CE-CKDGFQGDGQTCTDVDECTDGLHDCNVNAFCTN 436 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 +T Y C C SG+Q +G TC D+DEC D C C N Sbjct: 641 NTPGSYLCR-CKSGFQGDGKTCADIDECSDGSHDCHVNAICTN 682 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 Query: 307 DECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 DEC G A C R C++TP SY C C Y Sbjct: 5355 DECLLGLAKCDRNAHCIDTPESYRC-ECNNGY 5385 Score = 33.5 bits (73), Expect = 0.20 Identities = 21/71 (29%), Positives = 29/71 (40%), Gaps = 6/71 (8%) Frame = +2 Query: 8 VGSASTCVTLRSPAARERRCMPKS----TSPYYECEGCPSGYQWNGYTCVDMDECD--LI 169 VG TCV + C + + Y C+ C G++ +G C D+DEC L Sbjct: 204 VGDGKTCVDKDECVEEDHDCAKSADCINSVGSYSCQ-CRPGFEGDGKQCKDVDECASVLH 262 Query: 170 RPCDDLVSCRN 202 CD C N Sbjct: 263 NKCDPNALCTN 273 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 Y C C GY +G TC D+DEC + CD C N Sbjct: 278 YVCR-CKKGYTGDGITCKDIDECTNKTDDCDANALCTN 314 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDLIR-PCDDLVSCRN 202 C GY +G TC+D DEC L + CD C N Sbjct: 528 CLRGYIGDGKTCIDFDECKLPKNDCDVNAECIN 560 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GYQ +G TC D+DEC Sbjct: 445 CIRGYQGDGRTCADVDEC 462 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +1 Query: 268 TGNERRREHCVDVDECADGRAN-CPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSL 444 T ++ R+ +DEC N C LC N G+++C G +V + C D D Sbjct: 159 TKTKQSRKIRQHIDECKVTELNNCDANALCTNIFGTFVCRCRKG--FVGDGKTCVDKDEC 216 Query: 445 VK 450 V+ Sbjct: 217 VE 218 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSC 196 Y C C G+ NG TC D+ C DL +C Sbjct: 565 YSCI-CKPGFTGNGKTCTDLGPVKCDPTCGDLETC 598 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C G+ +G TCVD DEC Sbjct: 199 CRKGFVGDGKTCVDKDEC 216 >SB_48923| Best HMM Match : EGF_CA (HMM E-Value=3.2e-27) Length = 83 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/41 (53%), Positives = 23/41 (56%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 C D+DECA G ANCP CVN GSY C G VN T Sbjct: 40 CEDIDECALGVANCPASADCVNNDGSYTCRCKRGFTLVNNT 80 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/55 (40%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSL-VKRCDPS 465 +DEC + CP R CVN GSY C G+ VN T D +L V C S Sbjct: 2 IDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLVNNTCEDIDECALGVANCPAS 56 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +2 Query: 41 SPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRNEE 208 S R C+ S Y C+ C GY TC D+DEC L + C C N + Sbjct: 10 STCPANRYCVNNDGS--YTCK-CKPGYTLVNNTCEDIDECALGVANCPASADCVNND 63 >SB_57139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 854 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/74 (36%), Positives = 33/74 (44%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 G +G E C D+DEC+ G A CP C+NTPGSY C G+ T C D Sbjct: 249 GIKGWHAELMLGECKDIDECSRG-ALCPANARCINTPGSYHCACVNGYTGQGT---CMDV 304 Query: 436 DSLVKRCDPSYCRR 477 D D C + Sbjct: 305 DECA--ADDGLCHK 316 Score = 43.2 bits (97), Expect = 2e-04 Identities = 31/85 (36%), Positives = 40/85 (47%), Gaps = 6/85 (7%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVK-----RCD 459 C+DVDECA C +G CVNT GSY C T PCF+ + V C+ Sbjct: 301 CMDVDECAADDGLCHKGTTCVNTMGSYRCQDIN----ECLTDPCFEGEICVNSYGSFNCE 356 Query: 460 -PSYCRRFNAVCGFGQKSFVIPVGL 531 P +R+ V G +K I VG+ Sbjct: 357 LPPTTKRW--VSGCAEKLMPIGVGV 379 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 62 RCMPKSTSPYYECEGCPSGYQWNGYTCVDMDEC 160 RC+ +T Y C C +GY G TC+D+DEC Sbjct: 279 RCI--NTPGSYHC-ACVNGYTGQG-TCMDVDEC 307 >SB_50806| Best HMM Match : EGF_CA (HMM E-Value=1e-27) Length = 286 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/76 (35%), Positives = 38/76 (50%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRRF 480 D+DECAD ++ CP +C NT GSY CV G + + C D D + P+ C Sbjct: 145 DIDECADKQSRCPNNAVCKNTAGSYDCVCKKG--FEMSDGECKDIDECSLK--PAKCSS- 199 Query: 481 NAVCGFGQKSFVIPVG 528 N++C Q S+ G Sbjct: 200 NSICSNTQGSYKCECG 215 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/41 (43%), Positives = 21/41 (51%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCG 393 G E C D+DEC+ A C +C NT GSY C CG Sbjct: 176 GFEMSDGECKDIDECSLKPAKCSSNSICSNTQGSYKC-ECG 215 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +2 Query: 74 KSTSPYYECEGCPSGYQWNGYTCVDMDECDLIRP--CDDLVSCRNEE 208 K+T+ Y+C C G++ + C D+DEC L +P C C N + Sbjct: 163 KNTAGSYDCV-CKKGFEMSDGECKDIDECSL-KPAKCSSNSICSNTQ 207 >SB_47176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 46.4 bits (105), Expect = 3e-05 Identities = 31/81 (38%), Positives = 36/81 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C NT GSY C C + N R C D Sbjct: 295 PGFSGNGRE-----CTDIDECVTGDHTCDKNARCGNTIGSYHCT-CNPGFSGN-GRECTD 347 Query: 433 PDSLVKRCDPSYCRRFNAVCG 495 D V C + NA CG Sbjct: 348 TDECV--TGDHTCDK-NARCG 365 Score = 46.4 bits (105), Expect = 3e-05 Identities = 25/62 (40%), Positives = 30/62 (48%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C N GSY C+ C +Y N R C D Sbjct: 377 PGFSGNGRE-----CTDIDECVTGDYTCDKNAKCRNNIGSYDCM-CMSGFYGNGAR-CHD 429 Query: 433 PD 438 D Sbjct: 430 ID 431 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/65 (40%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D DEC G C + C NT GSY C C + N R C D Sbjct: 336 PGFSGNGRE-----CTDTDECVTGDHTCDKNARCGNTIGSYHCT-CNPGFSGN-GRECTD 388 Query: 433 PDSLV 447 D V Sbjct: 389 IDECV 393 Score = 43.2 bits (97), Expect = 2e-04 Identities = 30/81 (37%), Positives = 36/81 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C N GSY C+ C + N R C D Sbjct: 254 PGFSGDGRE-----CTDIDECVTGDHTCDKNAKCNNIIGSYHCM-CNPGFSGN-GRECTD 306 Query: 433 PDSLVKRCDPSYCRRFNAVCG 495 D V C + NA CG Sbjct: 307 IDECV--TGDHTCDK-NARCG 324 Score = 42.3 bits (95), Expect = 4e-04 Identities = 24/62 (38%), Positives = 28/62 (45%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C NT GSY C G + R C D Sbjct: 90 PGFSGDGRE-----CTDIDECVTGDHTCDKNARCNNTIGSYHCTCNPG--FSGDGRNCTD 142 Query: 433 PD 438 D Sbjct: 143 ID 144 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/65 (38%), Positives = 30/65 (46%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DECA G C + C NT GSY C G + R C D Sbjct: 131 PGFSGDGR-----NCTDIDECATGDHTCDKNAKCNNTIGSYHCRCNPG--FSGDGRNCTD 183 Query: 433 PDSLV 447 D V Sbjct: 184 IDECV 188 Score = 42.3 bits (95), Expect = 4e-04 Identities = 24/65 (36%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C NT GSY C G + R C D Sbjct: 213 PGFSGDGR-----NCTDIDECVTGDHTCDKNAKCNNTIGSYHCTCNPG--FSGDGRECTD 265 Query: 433 PDSLV 447 D V Sbjct: 266 IDECV 270 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/52 (38%), Positives = 25/52 (48%) Frame = +1 Query: 292 HCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLV 447 +C D+DEC G C + C NT GSY C+ G + R C D D V Sbjct: 57 NCTDIDECVTGDHTCDKNAKCNNTIGSYHCMCNPG--FSGDGRECTDIDECV 106 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/65 (35%), Positives = 28/65 (43%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C N GSY C G + R C D Sbjct: 172 PGFSGDGR-----NCTDIDECVTGDHTCDKNARCNNIIGSYHCTCNPG--FSGDGRNCTD 224 Query: 433 PDSLV 447 D V Sbjct: 225 IDECV 229 Score = 37.5 bits (83), Expect = 0.012 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D+DEC DG C +C NT GS+ C Sbjct: 427 CHDIDECRDGSHKCSPHAICYNTLGSFKC 455 Score = 36.3 bits (80), Expect = 0.028 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + RC +T Y C C G+ NG C D+DEC CD CRN Sbjct: 351 CVTGDHTCDKNARC--GNTIGSYHCT-CNPGFSGNGRECTDIDECVTGDYTCDKNAKCRN 407 Score = 34.7 bits (76), Expect = 0.086 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + RC +T Y C C G+ +G C D+DEC CD C N Sbjct: 105 CVTGDHTCDKNARC--NNTIGSYHCT-CNPGFSGDGRNCTDIDECATGDHTCDKNAKCNN 161 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/60 (35%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + RC +T Y C C G+ NG C D DEC CD C N Sbjct: 310 CVTGDHTCDKNARC--GNTIGSYHCT-CNPGFSGNGRECTDTDECVTGDHTCDKNARCGN 366 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 228 CVTGDHTCDKNAKC--NNTIGSYHCT-CNPGFSGDGRECTDIDECVTGDHTCDKNAKCNN 284 Score = 32.7 bits (71), Expect = 0.35 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 CVT + +C S Y+C C SG+ NG C D+DEC D C C N Sbjct: 392 CVTGDYTCDKNAKCRNNIGS--YDCM-CMSGFYGNGARCHDIDECRDGSHKCSPHAICYN 448 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 64 CVTGDHTCDKNAKC--NNTIGSYHCM-CNPGFSGDGRECTDIDECVTGDHTCDKNARCNN 120 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/60 (31%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + RC + Y C C G+ +G C D+DEC CD C N Sbjct: 187 CVTGDHTCDKNARC--NNIIGSYHCT-CNPGFSGDGRNCTDIDECVTGDHTCDKNAKCNN 243 Score = 31.5 bits (68), Expect = 0.80 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 C T + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 146 CATGDHTCDKNAKC--NNTIGSYHCR-CNPGFSGDGRNCTDIDECVTGDHTCDKNARCNN 202 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/60 (31%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C + Y C C G+ NG C D+DEC CD C N Sbjct: 269 CVTGDHTCDKNAKC--NNIIGSYHCM-CNPGFSGNGRECTDIDECVTGDHTCDKNARCGN 325 >SB_15410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1147 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICV 384 PG+ G G+ C DVDEC G A C CVNTPGS+ CV Sbjct: 411 PGFIGDGSS-----CTDVDECTTGIAQCSEQGTCVNTPGSHRCV 449 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 C+DVDEC + C G +C NTPGS+ C+ G+ T C D Sbjct: 337 CIDVDECQEDPRLCTNG-VCRNTPGSFECLCAKGYAIAKGTTACVD 381 Score = 42.3 bits (95), Expect = 4e-04 Identities = 30/94 (31%), Positives = 42/94 (44%), Gaps = 9/94 (9%) Frame = +1 Query: 262 RGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT-RPCFDPD 438 RG + + CVD++EC C +C NT GSY+C CG + + R C D D Sbjct: 242 RGFESTADMKDCVDINECLVDNGRC--SEMCNNTLGSYLC-DCGAGFALQPDGRTCRDID 298 Query: 439 SLVKR---CDP-SYCRR----FNAVCGFGQKSFV 516 ++R C P + C + CG G K V Sbjct: 299 ECMERPDVCGPGNTCNNIEGGYYCTCGKGYKQSV 332 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/67 (37%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNT-TRPCFDPDSLVKRCDPSYC 471 C D+DEC + C G C N G Y C CG Y + +R C D D + DP C Sbjct: 294 CRDIDECMERPDVCGPGNTCNNIEGGYYCT-CGKGYKQSVDSRSCIDVDECQE--DPRLC 350 Query: 472 RRFNAVC 492 N VC Sbjct: 351 T--NGVC 355 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/48 (39%), Positives = 23/48 (47%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 CVDV+EC G+A C C N GSY C G ++ C D D Sbjct: 379 CVDVNECQTGQAMCHENARCANLVGSYRCECKPG--FIGDGSSCTDVD 424 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 262 RGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 +G G R C D+DEC+ C G C NTPG++ C Sbjct: 118 QGYGLTADRMDCEDIDECSISAGLCGNG-TCTNTPGAFRC 156 Score = 36.3 bits (80), Expect = 0.028 Identities = 30/101 (29%), Positives = 44/101 (43%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRRF 480 DVDEC + C G+ C NT GSYIC G + ++ C D D C + Sbjct: 902 DVDECKELPDICREGK-CQNTIGSYICTCPKGLRHDPSSGKCKDIDE---------CAEY 951 Query: 481 NAVCGFGQKSFVIPVGLATAQCADWTEI*TDIRTSSCLVMS 603 + +CG + V VG C ++ D +T+ C+ S Sbjct: 952 HHLCGL-KGQCVNTVGSYRCNCPPGIDL--DRKTNMCITGS 989 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 262 RGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 +G ++ C D+DECA+ C CVNT GSY C Sbjct: 931 KGLRHDPSSGKCKDIDECAEYHHLCGLKGQCVNTVGSYRC 970 Score = 34.3 bits (75), Expect = 0.11 Identities = 25/73 (34%), Positives = 30/73 (41%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+R E C+D+DEC C G C NT GSY CV G + C D Sbjct: 160 PGFRNA--PMMMEICIDIDECDHNP--CADGT-CYNTMGSYKCVCPDGMELMKDGVSCED 214 Query: 433 PDSLVKRCDPSYC 471 + DP C Sbjct: 215 KNEC---SDPGVC 224 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 C T ++ RC S Y CE C G+ +G +C D+DEC I C + +C N Sbjct: 385 CQTGQAMCHENARCANLVGS--YRCE-CKPGFIGDGSSCTDVDECTTGIAQCSEQGTCVN 441 Score = 32.3 bits (70), Expect = 0.46 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 6/75 (8%) Frame = +2 Query: 2 ETVGSASTCVTLRSPAARERRC--MPKSTSPYYECEGCPSGY--QWNGYTCVDMDECDLI 169 E+ CV + RC M +T Y C+ C +G+ Q +G TC D+DEC + Sbjct: 245 ESTADMKDCVDINECLVDNGRCSEMCNNTLGSYLCD-CGAGFALQPDGRTCRDIDEC-ME 302 Query: 170 RP--CDDLVSCRNEE 208 RP C +C N E Sbjct: 303 RPDVCGPGNTCNNIE 317 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTR-PCFD 432 GW GT + D++EC + C GR CVN G++ C+ C Y + R C D Sbjct: 75 GW-GTPCQECPLQNTDINECNTWQGLCRNGR-CVNKQGTFECI-CNQGYGLTADRMDCED 131 Query: 433 PD 438 D Sbjct: 132 ID 133 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 340 RGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 R +CVNTPGSY C G + C D Sbjct: 7 RNGICVNTPGSYRCECSAGLTLDSIQNACVD 37 >SB_43576| Best HMM Match : EGF_CA (HMM E-Value=2.7e-38) Length = 641 Score = 46.0 bits (104), Expect = 3e-05 Identities = 26/70 (37%), Positives = 31/70 (44%), Gaps = 2/70 (2%) Frame = +1 Query: 268 TGNERRREHCVDVDECADGRANC--PRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDS 441 TG C DV+EC +G ANC C+NT GSY C G+ Y R C D D Sbjct: 384 TGYHGDGYQCHDVNECQEGLANCGDDTKSQCINTVGSYKCSCNTGYQYQGNERVCKDIDE 443 Query: 442 LVKRCDPSYC 471 + D C Sbjct: 444 CKSKDDCLQC 453 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +1 Query: 265 GTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 G + ++ C+DVDEC G NC C+N Y C G++ Sbjct: 342 GLAWDEKKRKCIDVDECMTGTHNCSTTAECLNIVSGYTCTCKTGYH 387 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +1 Query: 301 DVDECADGRANCPRG--RLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 D DEC + CP LC NT GSY C G + R C D D Sbjct: 310 DFDECTNSTI-CPDSDRMLCTNTVGSYTCSCDTGLAWDEKKRKCIDVD 356 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +2 Query: 92 YECEGCPSGYQWNGY--TCVDMDECDLIRPCDDLVSCRNE 205 Y+C C +GYQ+ G C D+DEC + DD + C N+ Sbjct: 421 YKCS-CNTGYQYQGNERVCKDIDEC---KSKDDCLQCTNQ 456 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDEC 160 Y C C +GY +GY C D++EC Sbjct: 378 YTCT-CKTGYHGDGYQCHDVNEC 399 >SB_7289| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 278 Score = 45.6 bits (103), Expect = 5e-05 Identities = 26/65 (40%), Positives = 31/65 (47%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C NT GSY C+ C + N R C D Sbjct: 203 PGFSGNGRE-----CTDIDECVTGDHTCDKNARCNNTIGSYHCM-CNPGFSGN-GRECTD 255 Query: 433 PDSLV 447 D V Sbjct: 256 IDECV 260 Score = 45.2 bits (102), Expect = 6e-05 Identities = 26/65 (40%), Positives = 31/65 (47%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C NT GSY C+ C + N R C D Sbjct: 162 PGFSGDGRE-----CTDIDECVTGDHTCDKNARCNNTIGSYHCM-CNPGFSGN-GRECTD 214 Query: 433 PDSLV 447 D V Sbjct: 215 IDECV 219 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/65 (38%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C NT GSY C G + R C D Sbjct: 80 PGFSGDGRE-----CTDIDECVTGDHTCDKNAKCNNTIGSYHCTCNPG--FSGGGRNCTD 132 Query: 433 PDSLV 447 D V Sbjct: 133 IDECV 137 Score = 42.3 bits (95), Expect = 4e-04 Identities = 24/65 (36%), Positives = 30/65 (46%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C NT GSY C+ G + R C D Sbjct: 121 PGFSGGGR-----NCTDIDECVTGDHTCDKNAKCNNTIGSYHCMCNPG--FSGDGRECTD 173 Query: 433 PDSLV 447 D V Sbjct: 174 IDECV 178 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +1 Query: 292 HCVDVDECADGRANCPRGRLCVNTPGSYIC 381 +C D+DECA G C + C NT GSY C Sbjct: 6 NCTDIDECATGDHTCDKNARCNNTIGSYHC 35 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/65 (35%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C NT G Y C+ G + R C D Sbjct: 39 PGFSGDGI-----NCTDIDECVTGDHTCDKNAKCNNTIGLYHCMCNPG--FSGDGRECTD 91 Query: 433 PDSLV 447 D V Sbjct: 92 IDECV 96 Score = 35.1 bits (77), Expect = 0.065 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + RC +T Y C C G+ NG C D+DEC CD C N Sbjct: 177 CVTGDHTCDKNARC--NNTIGSYHCM-CNPGFSGNGRECTDIDECVTGDHTCDKNARCNN 233 Score = 35.1 bits (77), Expect = 0.065 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + RC +T Y C C G+ NG C D+DEC CD C N Sbjct: 218 CVTGDHTCDKNARC--NNTIGSYHCM-CNPGFSGNGRECTDIDECVTGDHTCDKNARCNN 274 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPG 369 PG+ G G E C D+DEC G C + C NT G Sbjct: 244 PGFSGNGRE-----CTDIDECVTGDHTCDKNARCNNTIG 277 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/60 (31%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 C T + RC +T Y C C G+ +G C D+DEC CD C N Sbjct: 13 CATGDHTCDKNARC--NNTIGSYHCT-CNPGFSGDGINCTDIDECVTGDHTCDKNAKCNN 69 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 54 CVTGDHTCDKNAKC--NNTIGLYHCM-CNPGFSGDGRECTDIDECVTGDHTCDKNAKCNN 110 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/60 (31%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ G C D+DEC CD C N Sbjct: 95 CVTGDHTCDKNAKC--NNTIGSYHCT-CNPGFSGGGRNCTDIDECVTGDHTCDKNAKCNN 151 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 136 CVTGDHTCDKNAKC--NNTIGSYHCM-CNPGFSGDGRECTDIDECVTGDHTCDKNARCNN 192 >SB_48850| Best HMM Match : EGF_CA (HMM E-Value=2.1e-27) Length = 83 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 C D+DECA G ANCP C N GSY C G+ VN T Sbjct: 40 CEDIDECALGVANCPASADCFNYDGSYTCRCKRGYTLVNKT 80 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/55 (40%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSL-VKRCDPS 465 +DEC + CP R CVN GSY C G+ VN T D +L V C S Sbjct: 2 IDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLVNNTCEDIDECALGVANCPAS 56 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = +2 Query: 41 SPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 S R C+ S Y C+ C GY TC D+DEC L + C C N Sbjct: 10 STCPANRYCVNNDGS--YTCK-CKPGYTLVNNTCEDIDECALGVANCPASADCFN 61 >SB_5527| Best HMM Match : EGF_CA (HMM E-Value=1e-26) Length = 83 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/29 (62%), Positives = 19/29 (65%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D+DECA G ANCP CVN GSY C Sbjct: 40 CEDIDECALGVANCPASADCVNNDGSYTC 68 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/55 (40%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSL-VKRCDPS 465 +DEC + CP R CVN GSY C G+ VN T D +L V C S Sbjct: 2 IDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLVNNTCEDIDECALGVANCPAS 56 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +2 Query: 41 SPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRNEE 208 S R C+ S Y C+ C GY TC D+DEC L + C C N + Sbjct: 10 STCPANRYCVNNDGS--YTCK-CKPGYTLVNNTCEDIDECALGVANCPASADCVNND 63 >SB_2182| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 299 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 C D++ECA G ANCP CVN GSY C G VN T Sbjct: 194 CEDINECALGVANCPASADCVNNNGSYTCRCKPGFTLVNNT 234 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/41 (46%), Positives = 22/41 (53%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 C D+DEC + CP R CVN GSY C G+ VN T Sbjct: 153 CDDIDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLVNNT 193 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 D+DECA G A CP CVN GSY C G+ VN T Sbjct: 9 DIDECALGVATCPASADCVNNDGSYTCRCKRGYTLVNKT 47 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/39 (51%), Positives = 21/39 (53%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 D+DECA G A CP CVN GSY C G VN T Sbjct: 258 DIDECALGVATCPASADCVNNNGSYTCRCKRGFTLVNNT 296 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = +2 Query: 41 SPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 S R C+ S Y C+ C GY TC D++EC L + C C N Sbjct: 164 STCPANRYCVNNDGS--YTCK-CKPGYTLVNNTCEDINECALGVANCPASADCVN 215 >SB_58993| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 541 Score = 44.8 bits (101), Expect = 8e-05 Identities = 30/69 (43%), Positives = 35/69 (50%), Gaps = 6/69 (8%) Frame = +1 Query: 286 REHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNT----TRPCFDPDSLVKR 453 R HC+DV+EC D C GR C NT G C C Y +NT TR C D V Sbjct: 32 RRHCIDVNECQDVPGFCENGR-CTNTIGGARC-ECVAGYALNTEGKITR-CVD----VNE 84 Query: 454 CD--PSYCR 474 CD P++CR Sbjct: 85 CDENPNFCR 93 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/52 (42%), Positives = 26/52 (50%) Frame = +1 Query: 277 ERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 E + CVDV+EC + C G CVNTPGSY C+ G N C D Sbjct: 73 EGKITRCVDVNECDENPNFCRPGGRCVNTPGSYRCLCDPGFQSYNGGTVCVD 124 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/59 (33%), Positives = 27/59 (45%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 G+RG G C D++EC + R C G CVN G Y+C G+ + C D Sbjct: 340 GYRGDGRT-----CTDINECQERRGLCRNG-ACVNIDGGYVCNCNPGYKRSKNGKRCED 392 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDEC 160 Y C CP GY+ +G TC D++EC Sbjct: 333 YRCT-CPDGYRGDGRTCTDINEC 354 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/73 (27%), Positives = 31/73 (42%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRR 477 +D +EC + C G C N GSY C G+ + C D + C++ Sbjct: 268 LDKNECVETPGICKTGN-CTNIEGSYTCTCPVGYAPTRDSPSCSDINE---------CKK 317 Query: 478 FNAVCGFGQKSFV 516 +C +G K+FV Sbjct: 318 NPELCPYGCKNFV 330 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/63 (31%), Positives = 24/63 (38%) Frame = +1 Query: 265 GTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSL 444 G R C D++EC CP G C N G Y C G Y R C D + Sbjct: 299 GYAPTRDSPSCSDINECKKNPELCPYG--CKNFVGGYRCTCPDG--YRGDGRTCTDINEC 354 Query: 445 VKR 453 +R Sbjct: 355 QER 357 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = +1 Query: 328 ANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCD--PSYC 471 A+ R +C+NT GS+ C G+ R C D V C P +C Sbjct: 3 ADVCRNGMCINTEGSFTCQCIAGYTLSADRRHCID----VNECQDVPGFC 48 >SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 921 Score = 44.8 bits (101), Expect = 8e-05 Identities = 28/81 (34%), Positives = 35/81 (43%), Gaps = 2/81 (2%) Frame = +1 Query: 277 ERRREHCVDVDECA--DGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVK 450 + R E CVD+DECA G+ +C LC NT GS+ C C Y + C D D Sbjct: 552 DARTEQCVDIDECARNHGKGDCE--HLCTNTVGSFSC-SCHQGYRLKGKHQCVDVD---- 604 Query: 451 RCDPSYCRRFNAVCGFGQKSF 513 C + R C SF Sbjct: 605 ECSDNSLNRCQQTCNNSIGSF 625 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/60 (33%), Positives = 25/60 (41%) Frame = +1 Query: 292 HCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYC 471 HC DV+EC C + C+NT GSY C G+ T C D D + C Sbjct: 515 HCSDVNECEVQNGGCGK-HTCINTYGSYKCQCLDGYRLDARTEQCVDIDECARNHGKGDC 573 Score = 38.7 bits (86), Expect = 0.005 Identities = 31/101 (30%), Positives = 43/101 (42%), Gaps = 1/101 (0%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRP-CFDPDSLVKRCDPSYC 471 C+D+DEC +G C C+N GSY C CG + N + C D V C+ Sbjct: 476 CMDIDECMEGIPECFN---CINLRGSYRC-ECGQGFVPNANQTHCSD----VNECEVQ-- 525 Query: 472 RRFNAVCGFGQKSFVIPVGLATAQCADWTEI*TDIRTSSCL 594 N C G+ + + G QC D + D RT C+ Sbjct: 526 ---NGGC--GKHTCINTYGSYKCQCLDGYRL--DARTEQCV 559 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +1 Query: 289 EHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 + C+D DEC++ C +C+N PGSY C G + R C D D Sbjct: 309 KQCIDDDECSNPN-RCDH--VCINNPGSYACACHKGFFLKLDERSCADLD 355 Score = 34.7 bits (76), Expect = 0.086 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 C D+DECA + C C NT G Y C G+ + C D Sbjct: 393 CQDIDECAINKGGC--SHTCQNTAGGYQCQCPRGYIMQQDNKTCED 436 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +1 Query: 295 CVDVDEC-ADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C D+DEC C +LC+NT GSY C G+ ++ + C D D Sbjct: 351 CADLDECFLLNNGGC--SQLCLNTQGSYRCACDYGYRLLSDGKTCQDID 397 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/65 (27%), Positives = 27/65 (41%), Gaps = 2/65 (3%) Frame = +1 Query: 262 RGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRP--CFDP 435 RG ++ + C D++EC C CVN G + C C Y + P C D Sbjct: 423 RGYIMQQDNKTCEDINECETSNGGCE--HRCVNDKGGFRC-ECYAGYMQDVMMPSRCMDI 479 Query: 436 DSLVK 450 D ++ Sbjct: 480 DECME 484 >SB_23501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/48 (45%), Positives = 25/48 (52%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 CVD DEC C + CVNTPGSY+C G Y T+ C D D Sbjct: 38 CVDKDECMMTPNLCGEAK-CVNTPGSYVCKCNSGFEYNPQTKTCGDKD 84 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/33 (54%), Positives = 21/33 (63%) Frame = +2 Query: 62 RCMPKSTSPYYECEGCPSGYQWNGYTCVDMDEC 160 RC+ +T + CE CP GY NG TCVD DEC Sbjct: 15 RCV--NTVGSFRCE-CPIGYMKNGVTCVDKDEC 44 Score = 33.5 bits (73), Expect = 0.20 Identities = 26/80 (32%), Positives = 32/80 (40%), Gaps = 2/80 (2%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDP-SY- 468 C DV+EC + N G C NT GSY C G+ R C D + +P SY Sbjct: 121 CQDVNEC---QTNPCGGAQCQNTLGSYYCGCAQGNILAPNRRSCQDINECSMGINPCSYG 177 Query: 469 CRRFNAVCGFGQKSFVIPVG 528 C N S P+G Sbjct: 178 CNNNNGGFSCACPSGFYPIG 197 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/57 (38%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYIC-VPCGGHYYVNTTRPCFDPDSLVKRCDPSYC 471 VDEC G NC CVNT GS+ C P G Y+ C D D + P+ C Sbjct: 2 VDECKTGAHNCQYR--CVNTVGSFRCECPIG---YMKNGVTCVDKDECM--MTPNLC 51 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 286 REHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 R C D++EC+ G C G C N G + C G Y Sbjct: 158 RRSCQDINECSMGINPCSYG--CNNNNGGFSCACPSGFY 194 >SB_17530| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 165 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 271 GNERRRE-HCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 G ER + C DV+EC G+ +C LC NT G++IC G Y+ + C D D Sbjct: 32 GYERNSQGKCADVNECKTGKHDCSVNALCTNTDGTFICRCLRG--YIGDGKTCIDFD 86 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPS 465 C+D DEC + +C C+N+ GSY C+ G + + C D + +CDP+ Sbjct: 82 CIDFDECKLPKNDCDVNAECINSIGSYSCICKPG--FTGNGKTCTDLGPV--KCDPT 134 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 VDEC G+ C +C N+ GS+ C C Y N+ C D Sbjct: 2 VDECKTGQVKCGENEVCANSLGSFTC-QCAEGYERNSQGKCAD 43 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDLIR-PCDDLVSCRN 202 C GY +G TC+D DEC L + CD C N Sbjct: 71 CLRGYIGDGKTCIDFDECKLPKNDCDVNAECIN 103 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSC 196 Y C C G+ NG TC D+ C DL +C Sbjct: 108 YSCI-CKPGFTGNGKTCTDLGPVKCDPTCGDLETC 141 >SB_43077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 44.4 bits (100), Expect = 1e-04 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 G+ C D+DEC G C +C+NTPGS+IC Sbjct: 856 GHSGNGRSCSDIDECGIGSHGCHSDAICINTPGSFIC 892 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C DVDEC G +C C NT GSY C GH R C D D Sbjct: 823 CSDVDECTLGTHSCHANAQCRNTIGSYSCRCNNGH--SGNGRSCSDID 868 Score = 35.9 bits (79), Expect = 0.037 Identities = 24/66 (36%), Positives = 27/66 (40%), Gaps = 2/66 (3%) Frame = +1 Query: 301 DVDECADGRANCPRG-RLCVNTPGSYICV-PCGGHYYVNTTRPCFDPDSLVKRCDPSYCR 474 D +EC++ C CVNTPGSY C P G Y N C D V C S Sbjct: 743 DYNECSEQSDECDHTLATCVNTPGSYACACPAG---YTNNGHVCDD----VNECGVSDSC 795 Query: 475 RFNAVC 492 N C Sbjct: 796 HVNGTC 801 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSCRN 202 +T Y C CP+GY NG+ C D++EC + C +C N Sbjct: 763 NTPGSYAC-ACPAGYTNNGHVCDDVNECGVSDSCHVNGTCVN 803 Score = 34.7 bits (76), Expect = 0.086 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 C +G+ +GY+C D+DEC L C CRN Sbjct: 812 CNAGFTGDGYSCSDVDECTLGTHSCHANAQCRN 844 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 74 KSTSPYYECEGCPSGYQWNGYTCVDMDECDL 166 ++T Y C C +G+ NG +C D+DEC + Sbjct: 843 RNTIGSYSCR-CNNGHSGNGRSCSDIDECGI 872 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C DV+EC + C CVNT GSY C+ G + C D D Sbjct: 783 CDDVNECGVSDS-CHVNGTCVNTVGSYGCICNAG--FTGDGYSCSDVD 827 >SB_5780| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 263 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/81 (37%), Positives = 36/81 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C NT GSY C C + N R C D Sbjct: 188 PGFSGDGR-----NCTDIDECVTGDHTCDKNAKCDNTIGSYHCT-CNPGFSGN-GRECTD 240 Query: 433 PDSLVKRCDPSYCRRFNAVCG 495 D V C + NA CG Sbjct: 241 TDECV--TGDHTCDK-NARCG 258 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/65 (38%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C NT GSY C G + R C D Sbjct: 24 PGFSGNGRE-----CTDIDECVTGDHTCDKNAKCNNTIGSYHCTCNPG--FSGDGRNCTD 76 Query: 433 PDSLV 447 D V Sbjct: 77 IDECV 81 Score = 42.7 bits (96), Expect = 3e-04 Identities = 24/65 (36%), Positives = 30/65 (46%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C NT GSY C+ G + R C D Sbjct: 65 PGFSGDGR-----NCTDIDECVTGDHTCDKNAKCDNTIGSYHCMCNPG--FSGDGRECTD 117 Query: 433 PDSLV 447 D V Sbjct: 118 IDECV 122 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/65 (36%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C NT GSY C G + R C D Sbjct: 147 PGFSGDGR-----NCTDIDECLTGDHTCDKNAKCNNTIGSYHCTCNPG--FSGDGRNCTD 199 Query: 433 PDSLV 447 D V Sbjct: 200 IDECV 204 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/62 (37%), Positives = 27/62 (43%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C N GSY C G + R C D Sbjct: 106 PGFSGDGRE-----CTDIDECVTGDHTCDKNAKCNNIIGSYHCTCNPG--FSGDGRNCTD 158 Query: 433 PD 438 D Sbjct: 159 ID 160 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPG 369 PG+ G G E C D DEC G C + C NT G Sbjct: 229 PGFSGNGRE-----CTDTDECVTGDHTCDKNARCGNTIG 262 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 39 CVTGDHTCDKNAKC--NNTIGSYHCT-CNPGFSGDGRNCTDIDECVTGDHTCDKNAKCDN 95 Score = 32.3 bits (70), Expect = 0.46 Identities = 20/60 (33%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ NG C D DEC CD C N Sbjct: 203 CVTGDHTCDKNAKC--DNTIGSYHCT-CNPGFSGNGRECTDTDECVTGDHTCDKNARCGN 259 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 Y C C G+ NG C D+DEC CD C N Sbjct: 18 YHCT-CNPGFSGNGRECTDIDECVTGDHTCDKNAKCNN 54 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 80 CVTGDHTCDKNAKC--DNTIGSYHCM-CNPGFSGDGRECTDIDECVTGDHTCDKNAKCNN 136 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 C+T + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 162 CLTGDHTCDKNAKC--NNTIGSYHCT-CNPGFSGDGRNCTDIDECVTGDHTCDKNAKCDN 218 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 CVT + +C + Y C C G+ +G C D+DEC CD C N Sbjct: 121 CVTGDHTCDKNAKC--NNIIGSYHCT-CNPGFSGDGRNCTDIDECLTGDHTCDKNAKCNN 177 >SB_3108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 631 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/81 (37%), Positives = 36/81 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C NT GSY C C + N R C D Sbjct: 513 PGFSGDGR-----NCTDIDECVTGDHTCDKNAKCDNTIGSYHCT-CNPGFSGN-GRECTD 565 Query: 433 PDSLVKRCDPSYCRRFNAVCG 495 D V C + NA CG Sbjct: 566 TDECV--TGDHTCDK-NARCG 583 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/65 (40%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D DEC G C + C NT GSY C C + N R C D Sbjct: 554 PGFSGNGRE-----CTDTDECVTGDHTCDKNARCGNTIGSYHCT-CNPGFSGN-GRECTD 606 Query: 433 PDSLV 447 D V Sbjct: 607 IDECV 611 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/43 (44%), Positives = 23/43 (53%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 PG+ G G E C D+DEC G C + +C NT GSY C Sbjct: 185 PGFSGDGRE-----CTDIDECVTGDHTCDKNAICNNTIGSYHC 222 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/65 (38%), Positives = 31/65 (47%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DECA G C + C NT GSY C+ G + R C D Sbjct: 226 PGFSGDGR-----NCTDIDECATGDHICDKNAKCNNTIGSYHCMCNPG--FSGDGRNCTD 278 Query: 433 PDSLV 447 D V Sbjct: 279 IDECV 283 Score = 42.7 bits (96), Expect = 3e-04 Identities = 24/65 (36%), Positives = 30/65 (46%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C NT GSY C+ G + R C D Sbjct: 267 PGFSGDGR-----NCTDIDECVTGDHTCDKNAKCNNTIGSYHCMCNPG--FSGDGRECTD 319 Query: 433 PDSLV 447 D V Sbjct: 320 IDECV 324 Score = 42.7 bits (96), Expect = 3e-04 Identities = 24/65 (36%), Positives = 30/65 (46%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C NT GSY C+ G + R C D Sbjct: 390 PGFSGDGR-----NCTDIDECVTGDHTCDKNAKCNNTIGSYHCMCNPG--FSGDGRECTD 442 Query: 433 PDSLV 447 D V Sbjct: 443 IDECV 447 Score = 42.3 bits (95), Expect = 4e-04 Identities = 24/65 (36%), Positives = 30/65 (46%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C NT GSY C+ G + R C D Sbjct: 472 PGFSGDGR-----NCTDIDECVTGDHTCDKNAKCNNTIGSYHCMCNPG--FSGDGRNCTD 524 Query: 433 PDSLV 447 D V Sbjct: 525 IDECV 529 Score = 41.9 bits (94), Expect = 6e-04 Identities = 24/65 (36%), Positives = 29/65 (44%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C NT GSY C G + R C D Sbjct: 349 PGFSGDGR-----NCTDIDECVTGDHTCDKNAKCNNTIGSYHCTCNPG--FSGDGRNCTD 401 Query: 433 PDSLV 447 D V Sbjct: 402 IDECV 406 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/65 (36%), Positives = 28/65 (43%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C N GSY C G + R C D Sbjct: 308 PGFSGDGRE-----CTDIDECVTGDHTCDKNAKCNNIIGSYHCTCNPG--FSGDGRNCTD 360 Query: 433 PDSLV 447 D V Sbjct: 361 IDECV 365 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/65 (36%), Positives = 28/65 (43%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G E C D+DEC G C + C N GSY C G + R C D Sbjct: 431 PGFSGDGRE-----CTDIDECVTGDHTCDKNAKCNNIIGSYHCTCNPG--FSGDGRNCTD 483 Query: 433 PDSLV 447 D V Sbjct: 484 IDECV 488 Score = 37.9 bits (84), Expect = 0.009 Identities = 26/79 (32%), Positives = 36/79 (45%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 G++G G + C + DEC+ G C + C NT GSY C+ G + R C D Sbjct: 145 GFKGDG-----QMCSETDECSAGNHTCGKNAKCNNTIGSYHCMCNPG--FSGDGRECTDI 197 Query: 436 DSLVKRCDPSYCRRFNAVC 492 D V C + NA+C Sbjct: 198 DECV--TGDHTCDK-NAIC 213 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSY 375 PG+ G G E C D+DEC G C + C N GSY Sbjct: 595 PGFSGNGRE-----CTDIDECVTGDHTCDKNAKCRNNIGSY 630 Score = 37.1 bits (82), Expect = 0.016 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + RC +T Y C C G+ NG C D+DEC CD CRN Sbjct: 569 CVTGDHTCDKNARC--GNTIGSYHCT-CNPGFSGNGRECTDIDECVTGDHTCDKNAKCRN 625 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 364 CVTGDHTCDKNAKC--NNTIGSYHCT-CNPGFSGDGRNCTDIDECVTGDHTCDKNAKCNN 420 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 282 CVTGDHTCDKNAKC--NNTIGSYHCM-CNPGFSGDGRECTDIDECVTGDHTCDKNAKCNN 338 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 405 CVTGDHTCDKNAKC--NNTIGSYHCM-CNPGFSGDGRECTDIDECVTGDHTCDKNAKCNN 461 Score = 32.3 bits (70), Expect = 0.46 Identities = 20/60 (33%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ NG C D DEC CD C N Sbjct: 528 CVTGDHTCDKNAKC--DNTIGSYHCT-CNPGFSGNGRECTDTDECVTGDHTCDKNARCGN 584 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 487 CVTGDHTCDKNAKC--NNTIGSYHCM-CNPGFSGDGRNCTDIDECVTGDHTCDKNAKCDN 543 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +2 Query: 56 ERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 ++ + +T Y C C G+ +G C D+DEC CD C N Sbjct: 208 DKNAICNNTIGSYHCR-CNPGFSGDGRNCTDIDECATGDHICDKNAKCNN 256 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C + Y C C G+ +G C D+DEC CD C N Sbjct: 323 CVTGDHTCDKNAKC--NNIIGSYHCT-CNPGFSGDGRNCTDIDECVTGDHTCDKNAKCNN 379 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C + Y C C G+ +G C D+DEC CD C N Sbjct: 446 CVTGDHTCDKNAKC--NNIIGSYHCT-CNPGFSGDGRNCTDIDECVTGDHTCDKNAKCNN 502 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 C T + +C +T Y C C G+ +G C D+DEC CD C N Sbjct: 241 CATGDHICDKNAKC--NNTIGSYHCM-CNPGFSGDGRNCTDIDECVTGDHTCDKNAKCNN 297 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 Y C C G+ +G C D+DEC CD C N Sbjct: 179 YHCM-CNPGFSGDGRECTDIDECVTGDHTCDKNAICNN 215 >SB_52309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/65 (38%), Positives = 31/65 (47%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C NT GSY C+ C + N R C D Sbjct: 86 PGFSGDGR-----NCTDIDECVTGNHTCDKNAKCNNTIGSYHCM-CNPGFSGN-GRNCTD 138 Query: 433 PDSLV 447 D V Sbjct: 139 IDECV 143 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/62 (35%), Positives = 28/62 (45%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG+ G G +C D+DEC G C + C N GS+ C C +Y N C D Sbjct: 127 PGFSGNGR-----NCTDIDECVTGNHACDKNARCRNNIGSHHCT-CKSGFYGNGA-SCDD 179 Query: 433 PD 438 D Sbjct: 180 ID 181 Score = 37.5 bits (83), Expect = 0.012 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D+DEC D C +C NT GS++C Sbjct: 177 CDDIDECRDASHKCSPHAICYNTLGSFVC 205 Score = 37.1 bits (82), Expect = 0.016 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + +C +T Y C C G+ NG C D+DEC CD CRN Sbjct: 101 CVTGNHTCDKNAKC--NNTIGSYHCM-CNPGFSGNGRNCTDIDECVTGNHACDKNARCRN 157 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 G+RG G +C D+DEC D C C NT GS+ C Sbjct: 210 GFRGNG-----AYCRDIDECRDASHKCSLHATCYNTLGSFRC 246 Score = 35.5 bits (78), Expect = 0.049 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +1 Query: 289 EHCVDV-DECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLV 447 ++C D DEC G C + C NT GSY C G + R C D D V Sbjct: 51 KNCTDANDECVTGNHTCDKNARCNNTIGSYHCTCNPG--FSGDGRNCTDIDECV 102 Score = 35.1 bits (77), Expect = 0.065 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 CVT + RC +T Y C C G+ +G C D+DEC CD C N Sbjct: 60 CVTGNHTCDKNARC--NNTIGSYHCT-CNPGFSGDGRNCTDIDECVTGNHTCDKNAKCNN 116 Score = 35.1 bits (77), Expect = 0.065 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 CVT + RC S + C C SG+ NG +C D+DEC D C C N Sbjct: 142 CVTGNHACDKNARCRNNIGS--HHCT-CKSGFYGNGASCDDIDECRDASHKCSPHAICYN 198 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 5/69 (7%) Frame = +2 Query: 11 GSASTCVTLRSPAARERRCMPKS----TSPYYECEGCPSGYQWNGYTCVDMDEC-DLIRP 175 G+ ++C + +C P + T + C C G++ NG C D+DEC D Sbjct: 172 GNGASCDDIDECRDASHKCSPHAICYNTLGSFVCS-CKDGFRGNGAYCRDIDECRDASHK 230 Query: 176 CDDLVSCRN 202 C +C N Sbjct: 231 CSLHATCYN 239 >SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3474 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 7/79 (8%) Frame = +1 Query: 286 REHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLV---KRC 456 + +C+D+DEC+ C + C N PGSY C G Y + + C D D +C Sbjct: 580 QRNCLDIDECSSNLHIC--NQTCNNVPGSYYCTCFPGFYLMMEDQSCVDIDECAAGFHQC 637 Query: 457 DPSYCRR----FNAVCGFG 501 + + C+ +N CG G Sbjct: 638 NQN-CQNIPGSYNCTCGLG 655 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +1 Query: 283 RREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 + + C+DVDEC+ NC + +CVN PGSY C G+ R C Sbjct: 864 KNDSCLDVDECSTSTHNCTQ--ICVNQPGSYTCHCHQGYQLAADQRSC 909 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 289 EHCVDVDECADGRANCPRGRLCVNTPGSYICVPCG-GHYYVNTTRPCFDPD 438 + CVD+DECA G C + C N PGSY C CG G+ + C D D Sbjct: 622 QSCVDIDECAAGFHQCNQN--CQNIPGSYNCT-CGLGYQLAYDKKNCLDID 669 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/48 (41%), Positives = 24/48 (50%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C+DVDEC A C + C N PGSY+C G+Y C D D Sbjct: 468 CLDVDECLTIPAIC--NQTCSNIPGSYVCSCVTGYYLGVDNTTCLDLD 513 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 286 REHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKR 453 +++C+D+DECA G+ C + C N G+Y C G C D D V R Sbjct: 662 KKNCLDIDECATGKHQCAQN--CTNIIGNYSCSCTTGFELAVDQTNCVDVDECVTR 715 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 CVDVDEC+ G A C + C N PGS+ C Sbjct: 550 CVDVDECSSGIAQC--NQTCANIPGSFTC 576 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = +1 Query: 259 WRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 +RG + + C+DV+EC+ G C ++C NT GS+ C G+ ++ C D D Sbjct: 776 YRGYALDSDKRTCIDVEECSSGAHGC--SQICNNTQGSFHCGCHQGYNLLDDLISCGDID 833 Query: 439 SLVKRCDPSYC 471 + C Sbjct: 834 ECATKVCSHNC 844 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/55 (41%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCG-GHYYVNTTRPCFDPDSLVKRC 456 CVDVDEC+ G C CVN G Y C CG G+ + R C S RC Sbjct: 393 CVDVDECSTGANVCNDN--CVNLYGKYTC-QCGPGYEFDWLNRRCCQKVSCFPRC 444 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C+D+DEC+ NC + C N+ GS+IC G+ + + C D D Sbjct: 509 CLDLDECSTNANNCEQR--CTNSLGSFICSCWTGYILGSDYKSCVDVD 554 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = +1 Query: 292 HCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 +CVDVDEC C + CVNT GSY C G + C D Sbjct: 705 NCVDVDECVTRSHKC--FQQCVNTRGSYKCSCNPGFVLASDNFGCLD 749 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/48 (39%), Positives = 21/48 (43%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C D+DECA C C NTPGSY C G+ C D D Sbjct: 829 CGDIDECAT--KVCSHN--CTNTPGSYRCSCFPGYQQGPKNDSCLDVD 872 Score = 32.3 bits (70), Expect = 0.46 Identities = 21/73 (28%), Positives = 32/73 (43%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCR 474 C+D++EC C +G C N G++ C G+ + R C D V+ C S Sbjct: 747 CLDINECKSSIKYCSQG--CKNLYGTFSCFCYRGYALDSDKRTCID----VEECS-SGAH 799 Query: 475 RFNAVCGFGQKSF 513 + +C Q SF Sbjct: 800 GCSQICNNTQGSF 812 Score = 28.7 bits (61), Expect = 5.7 Identities = 21/64 (32%), Positives = 26/64 (40%), Gaps = 2/64 (3%) Frame = +1 Query: 253 PGWR-GTGNERRREHCVDVDECADG-RANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 PG+ T NE VD C + C C+NTPGS+IC G + C Sbjct: 336 PGFNLTTSNETETSSGESVDGCYSVVQRFC--SHQCLNTPGSFICTCPEGLALSEDGKSC 393 Query: 427 FDPD 438 D D Sbjct: 394 VDVD 397 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 289 EHCVDVDECADGRANCP-RGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 E C D+DEC DG C G C NT GSY C G Y C D D Sbjct: 716 EACTDIDECTDGVHTCALNGSTCTNTVGSYTCACNAG--YTGNGETCADID 764 Score = 43.2 bits (97), Expect = 2e-04 Identities = 27/72 (37%), Positives = 30/72 (41%), Gaps = 4/72 (5%) Frame = +1 Query: 295 CVDVDECADGRANC-PRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVK---RCDP 462 C D+DEC G C P G +C NT GSY C G Y + C D D C P Sbjct: 507 CSDIDECTSGSHTCAPSGGVCTNTMGSYTCACDSG--YTGDGQICTDIDECSSGGHLCAP 564 Query: 463 SYCRRFNAVCGF 498 S N V F Sbjct: 565 SGSTCTNTVGAF 576 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/75 (38%), Positives = 31/75 (41%), Gaps = 5/75 (6%) Frame = +1 Query: 289 EHCV-DVDECADGRANC-PRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSL---VKR 453 E CV D+DEC+ G C P G C NT GSY C G Y C D D Sbjct: 631 ETCVEDIDECSSGAHTCAPSGSTCTNTVGSYTCACNVG--YTGDGETCVDIDECSAGSHT 688 Query: 454 CDPSYCRRFNAVCGF 498 C PS N V F Sbjct: 689 CAPSVSTCTNTVGSF 703 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/54 (42%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANC-PRGRLCVNTPGSYICVPCGGHYYVN 411 PG+ G G+ +C D DEC +G C P G C NT GSY C C Y N Sbjct: 961 PGFTGDGH-----NCTDFDECINGNHTCAPIGGNCTNTVGSYTCT-CTAEYVGN 1008 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/37 (48%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 295 CVDVDECADGRANC-PRGRLCVNTPGSYICVPCGGHY 402 C D+DEC+DG C P G C N GSY C C Y Sbjct: 591 CTDIDECSDGTNTCAPIGSSCTNNAGSYTC-SCNAGY 626 Score = 41.9 bits (94), Expect = 6e-04 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 289 EHCVDVDECADGRANC-PRGRLCVNTPGSYICVPCGGH 399 E C D+DEC+ G C P G C N GSY+C G+ Sbjct: 758 ETCADIDECSVGSHTCAPSGSTCTNNVGSYVCTCSTGY 795 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +1 Query: 289 EHCVDVDECADGRANC-PRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 E CVD+DEC+ G C P C NT GS+ C G Y C D D Sbjct: 674 ETCVDIDECSAGSHTCAPSVSTCTNTVGSFTCACNAG--YTGDGEACTDID 722 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 295 CVDVDECADGRANC-PRGRLCVNTPGSYICVPCGGHY 402 C D+DEC+ G C P G C NT G++ C C Y Sbjct: 549 CTDIDECSSGGHLCAPSGSTCTNTVGAFTCA-CNAGY 584 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 6/70 (8%) Frame = +2 Query: 11 GSASTCVTLRSPAARERRCMPKSTS-----PYYECEGCPSGYQWNGYTCVDMDECDLIRP 175 G+ TC + + C P ++ Y C C +GY +G TC D+DEC + Sbjct: 755 GNGETCADIDECSVGSHTCAPSGSTCTNNVGSYVCT-CSTGYSGDGDTCTDIDECTGLHT 813 Query: 176 CDDLVS-CRN 202 C + S C N Sbjct: 814 CASVGSTCTN 823 Score = 35.9 bits (79), Expect = 0.037 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 6/62 (9%) Frame = +2 Query: 11 GSASTCVTLRSPAARERRCMPK-----STSPYYECEGCPSGYQWNGYTCVDMDEC-DLIR 172 G TCV + +A C P +T + C C +GY +G C D+DEC D + Sbjct: 671 GDGETCVDIDECSAGSHTCAPSVSTCTNTVGSFTC-ACNAGYTGDGEACTDIDECTDGVH 729 Query: 173 PC 178 C Sbjct: 730 TC 731 Score = 35.1 bits (77), Expect = 0.065 Identities = 21/65 (32%), Positives = 24/65 (36%) Frame = +1 Query: 268 TGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLV 447 TG + C D+DEC G C N+ GSY C C Y C D S Sbjct: 793 TGYSGDGDTCTDIDECTGLHTCASVGSTCTNSVGSYSC-SC-NILYTGDGHTCTDLCSAE 850 Query: 448 KRCDP 462 C P Sbjct: 851 NSCAP 855 Score = 33.9 bits (74), Expect = 0.15 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL 166 Y C C +GY NG TC D+DEC + Sbjct: 745 YTC-ACNAGYTGNGETCADIDECSV 768 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 6/56 (10%) Frame = +2 Query: 11 GSASTCVT-LRSPAARERRCMPK-----STSPYYECEGCPSGYQWNGYTCVDMDEC 160 G TCV + ++ C P +T Y C C GY +G TCVD+DEC Sbjct: 628 GDGETCVEDIDECSSGAHTCAPSGSTCTNTVGSYTC-ACNVGYTGDGETCVDIDEC 682 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 7/71 (9%) Frame = +2 Query: 11 GSASTCVTLRSPAARERRCMPK-----STSPYYECEGCPSGYQWNGYTCVDMDEC-DLIR 172 G C + ++ C P +T + C C +GY +G TC D+DEC D Sbjct: 544 GDGQICTDIDECSSGGHLCAPSGSTCTNTVGAFTC-ACNAGYTGDGVTCTDIDECSDGTN 602 Query: 173 PCDDL-VSCRN 202 C + SC N Sbjct: 603 TCAPIGSSCTN 613 Score = 31.5 bits (68), Expect = 0.80 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDEC 160 +T Y C C SGY +G C D+DEC Sbjct: 529 NTMGSYTC-ACDSGYTGDGQICTDIDEC 555 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 298 VDVDECADGRANC-PRGRLCVNTPGSYIC 381 +D++ECA C P G C NT GS+ C Sbjct: 929 IDINECAADIFPCAPSGSNCTNTMGSFTC 957 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 6/56 (10%) Frame = +2 Query: 11 GSASTCVTLRSPAARERRCMPKSTS-----PYYECEGCPSGYQWNGYTCV-DMDEC 160 G TC + + C P +S Y C C +GY +G TCV D+DEC Sbjct: 586 GDGVTCTDIDECSDGTNTCAPIGSSCTNNAGSYTCS-CNAGYAGDGETCVEDIDEC 640 >SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/68 (39%), Positives = 32/68 (47%), Gaps = 5/68 (7%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTR----PCFDPDSLVKRCD- 459 C+D+DEC NC CVN GSY CV C Y+ N T CF S + CD Sbjct: 435 CIDIDECKTSAHNCHANATCVNKMGSYECV-CKEGYFGNGTHCEVDACFTRPS--RLCDK 491 Query: 460 PSYCRRFN 483 + CR N Sbjct: 492 DAVCRLEN 499 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +1 Query: 289 EHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 + C D +EC G C + +C+NT GSY CV C Y N T Sbjct: 594 DDCHDANECERGEHTCSKNAMCINTSGSYECV-CNDGYRGNGT 635 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 C D+DEC C + LC N PGSY C+ G++ Sbjct: 557 CTDIDECHQKAHLCNKNALCHNIPGSYKCMCLKGYH 592 Score = 37.1 bits (82), Expect = 0.016 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 PG+ G G C D+DEC NC C NT GSY C Sbjct: 345 PGYTGNGFT-----CNDIDECVLSAPNCSSHSYCSNTMGSYTC 382 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDLIRP-CDDLVSCRN 202 C GY NG+TC D+DEC L P C C N Sbjct: 343 CMPGYTGNGFTCNDIDECVLSAPNCSSHSYCSN 375 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 CVD++EC CP CVNT GSY C G++ ++ C D D Sbjct: 395 CVDLNECQK-HFYCPATSRCVNTLGSYKCRCLEGYHSAGSS--CIDID 439 Score = 33.9 bits (74), Expect = 0.15 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDLIRPCDDLVSCRN 202 C +GY +G TC D++EC L C +C N Sbjct: 506 CKAGYTGDGITCEDVNECQLPGSCHVHATCAN 537 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 62 RCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRNE 205 RC+ +T Y+C C GY G +C+D+DEC C +C N+ Sbjct: 412 RCV--NTLGSYKCR-CLEGYHSAGSSCIDIDECKTSAHNCHANATCVNK 457 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCR 474 C DV+EC +C C NT GS++C G ++ C D D ++ C Sbjct: 517 CEDVNEC-QLPGSCHVHATCANTNGSHVCTCNKG--FIGEGDLCTDIDECHQKA--HLCN 571 Query: 475 RFNAVC 492 + NA+C Sbjct: 572 K-NALC 576 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +3 Query: 510 VCNTGWTGNGTVC 548 VCN G+ GNGT+C Sbjct: 625 VCNDGYRGNGTIC 637 >SB_41134| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 802 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = +1 Query: 286 REHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 R C D+DEC D C G+LCVNT GSY C Sbjct: 377 RTRCQDIDECMDNNGGC--GQLCVNTAGSYHC 406 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/69 (36%), Positives = 30/69 (43%) Frame = +1 Query: 307 DECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRRFNA 486 DECA G C G CVNTPG+Y C+ G Y + C D D C + Sbjct: 665 DECASGIHQCEEGATCVNTPGNYSCLCPQG--YRSDWNKCVDID----ECADPQVNKCQH 718 Query: 487 VCGFGQKSF 513 +C Q SF Sbjct: 719 ICNNTQASF 727 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKR 453 +VDEC + C LC+NTPGS++C G+ N + C + + R Sbjct: 268 NVDECQNNNGGCRD--LCINTPGSFMCQCRQGYVLANDNKTCINLNECATR 316 Score = 37.5 bits (83), Expect = 0.012 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +1 Query: 295 CVDVDECADGRAN-CPRGRLCVNTPGSYICVPCGGHYYVNTTR-PCFDPDSLVKRCDPSY 468 CVD+DECAD + N C +C NT S+ C C Y +N+ C D D +R Sbjct: 702 CVDIDECADPQVNKCQ--HICNNTQASFHC-ECREGYILNSDGITCSDIDECKQRMCEKE 758 Query: 469 C 471 C Sbjct: 759 C 759 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +1 Query: 274 NERRREHCVDVDECAD--GRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 N+ CVD+DECA G+ +C C NT GS+ C G+ + C D D Sbjct: 552 NDAVARTCVDIDECAGHFGKGDC--DHKCNNTAGSFKCSCHHGYALTDDGLTCQDID 606 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 C D+DECA C + CVN+PG++ C G+ Sbjct: 602 CQDIDECAVDNGGC--HQKCVNSPGNFSCACHDGY 634 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 C D+DEC + C + CVNT GSY C G+ + R C Sbjct: 744 CSDIDECK--QRMCEKE--CVNTEGSYFCFCPPGYQLTDDKRHC 783 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +2 Query: 23 TCVTLRSPAARERRC--MPKSTSPYYECEGCPSGYQW--NGYTCV 145 TC+ L A R+ RC + + T Y CE C GYQ +G +C+ Sbjct: 306 TCINLNECATRKHRCEQLCRDTDGGYYCE-CHKGYQVGPDGMSCI 349 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDEC 160 +T Y C CP GY+ + CVD+DEC Sbjct: 682 NTPGNYSCL-CPQGYRSDWNKCVDIDEC 708 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWN--GYTCVDMDECDLIRPCDDLVSCRNEE 208 +T + CE C GY N G TC D+DEC R C+ C N E Sbjct: 722 NTQASFHCE-CREGYILNSDGITCSDIDECKQ-RMCEK--ECVNTE 763 >SB_50721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1057 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/52 (40%), Positives = 26/52 (50%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 G+ G+G E C D+DECA G + C +C NT G Y C C Y N Sbjct: 862 GYTGSG-----EVCTDIDECAVGTSTCDSNAVCSNTAGGYTCA-CKDEYTEN 907 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 C +GY +G C D+DEC + CD C N Sbjct: 859 CKAGYTGSGEVCTDIDECAVGTSTCDSNAVCSN 891 >SB_18560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1937 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D+DECA G ANC R CVN GS++C Sbjct: 1279 CRDIDECALGHANCHRKAECVNQLGSFVC 1307 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 G+RG G +C D DEC R C C+NT GSY C G Y + C + Sbjct: 692 GYRGDGVS----YCEDADECTLNRYRCDANAECINTVGSYRCKCKTG--YTGDGKTCTEA 745 Query: 436 DSLV--KRCDPS 465 + ++C P+ Sbjct: 746 EEFYCPQKCHPN 757 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 C D DEC G CP+ CVN GSY+C+ G+ VN Sbjct: 1364 CTDQDECLKGP--CPQNAKCVNNFGSYLCICNPGYKKVN 1400 Score = 38.7 bits (86), Expect = 0.005 Identities = 29/92 (31%), Positives = 39/92 (42%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVK 450 G ++ +C+++DEC GR C C NT GS+ C G +V C S Sbjct: 987 GFTKKEGNCINIDECEPGRNRCDPNADCRNTVGSFQCACQVG--FVGDGFVCTSDGS--- 1041 Query: 451 RCDPSYCRRFNAVCGFGQKSFVIPVGLATAQC 546 C + C NA CG + P GL QC Sbjct: 1042 -CGGTTC-DVNAKCG------LAPDGLPQCQC 1065 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 65 CMPKSTSPYYECEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 C+ + C+ C G++ NG C DMDEC L+R C CRN Sbjct: 930 CVTDDDTGRKRCQ-CRVGFRGNGVDCYDMDECIPLLRTCGSNSLCRN 975 Score = 37.5 bits (83), Expect = 0.012 Identities = 30/90 (33%), Positives = 36/90 (40%), Gaps = 8/90 (8%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 G+RG G + C D+DEC C LC NT G Y CV G + C + Sbjct: 946 GFRGNGVD-----CYDMDECIPLLRTCGSNSLCRNTLGGYECVCRRG--FTKKEGNCINI 998 Query: 436 DSLV---KRCDPSY-CRR----FNAVCGFG 501 D RCDP+ CR F C G Sbjct: 999 DECEPGRNRCDPNADCRNTVGSFQCACQVG 1028 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDLIRPCDDLVS-CRNEE 208 C GYQ NG C D++EC+ CD L + C N E Sbjct: 861 CERGYQGNGEDCKDINECEQNHECDPLKAVCTNTE 895 Score = 35.5 bits (78), Expect = 0.049 Identities = 21/70 (30%), Positives = 28/70 (40%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVK 450 G + E C D++EC P +C NT GSY C G Y R C + + Sbjct: 864 GYQGNGEDCKDINECEQNHECDPLKAVCTNTEGSYSCTCRPG--YGGDGRTC----TPIS 917 Query: 451 RCDPSYCRRF 480 C C +F Sbjct: 918 SCGGEVCHQF 927 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDLIR-PCDDLVSCRN 202 C+ L C ++T YEC C G+ C+++DEC+ R CD CRN Sbjct: 960 CIPLLRTCGSNSLC--RNTLGGYECV-CRRGFTKKEGNCINIDECEPGRNRCDPNADCRN 1016 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = +1 Query: 253 PGWRGTGNERRREHC--VDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 PG+ G G + C DV ECA C C++T GSY C G+ Sbjct: 774 PGYTGDGVSCEHDECFVADVKECAR-LDRCDPNADCIDTVGSYRCACKSGY 823 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDLIRPCDDLVSCRN 202 C G++ +G C D DEC L PC C N Sbjct: 1353 CKEGFEGDGIICTDQDEC-LKGPCPQNAKCVN 1383 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +2 Query: 62 RCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDLIRP-CDDLVSCRNE 205 +C+ S S C G+ NG C D+DEC L C C N+ Sbjct: 1253 KCIAASPSGENRTCACNDGFSGNGLFCRDIDECALGHANCHRKAECVNQ 1301 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 480 QRRLWFRTKVVCNTGWTGNGTVCGLDRDLDG 572 +R F T+ VCN G+ G+G C D +G Sbjct: 1215 KRNTAFGTRCVCNPGYLGDGRKCTADGTCEG 1245 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVN-TPGSYICVPCGGHYY 405 +DECA G A C C N PG C C +Y Sbjct: 71 LDECAVGSAQCHMNATCYNKAPG--FCCECDDRFY 103 >SB_45154| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) Length = 486 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 C D++ECADG C C NT GS+ C GH Sbjct: 443 CQDINECADGSHTCSNKATCTNTVGSFTCACKAGH 477 Score = 41.5 bits (93), Expect = 8e-04 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 C D++ECADG C C NT GS+ C GH Sbjct: 402 CQDINECADGSHTCSYKATCTNTVGSFTCACKAGH 436 Score = 36.3 bits (80), Expect = 0.028 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRC-DPSYCRRF 480 ++ECADG C C NT GS+ C G Y C D + C D S+ + Sbjct: 364 INECADGSHTCSNNATCTNTVGSFTCACNVG--YTGDGHTCQD----INECADGSHTCSY 417 Query: 481 NAVC 492 A C Sbjct: 418 KATC 421 Score = 35.1 bits (77), Expect = 0.065 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 5/69 (7%) Frame = +2 Query: 11 GSASTCVTLRSPAARERRCMPKSTSPY----YECEGCPSGYQWNGYTCVDMDEC-DLIRP 175 G TC + A C K+T + C C +G+ +G+TC D++EC D Sbjct: 397 GDGHTCQDINECADGSHTCSYKATCTNTVGSFTC-ACKAGHTGDGHTCQDINECADGSHT 455 Query: 176 CDDLVSCRN 202 C + +C N Sbjct: 456 CSNKATCTN 464 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 C GY +G+TC D++EC D C +C N Sbjct: 391 CNVGYTGDGHTCQDINECADGSHTCSYKATCTN 423 >SB_38935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 42.3 bits (95), Expect = 4e-04 Identities = 27/74 (36%), Positives = 33/74 (44%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVK 450 G E + C+DVDECA G C C+NT GS+ C G Y + C D D Sbjct: 177 GFEGDGKTCIDVDECAGGTEMCALEASCLNTLGSFRCNCMEG--YTGDGKTCQDIDECTN 234 Query: 451 RCDPSYCRRFNAVC 492 D C NA+C Sbjct: 235 ETDD--CDA-NALC 245 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/62 (33%), Positives = 29/62 (46%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 PG++G G C D+DEC + +C LC N PG Y+C G + + C D Sbjct: 53 PGFQGDGFT-----CEDIDECTNKTDDCDANALCTNVPGLYVCRCLKG--FEGDGKTCID 105 Query: 433 PD 438 D Sbjct: 106 VD 107 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/74 (36%), Positives = 34/74 (45%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVK 450 G E + C+DVDECA G A C C+NT GS+ C G Y + D D Sbjct: 95 GFEGDGKTCIDVDECAGGTAMCALEASCLNTLGSFRCNCMEG--YTGDGKTSQDIDECTN 152 Query: 451 RCDPSYCRRFNAVC 492 + D C NA+C Sbjct: 153 KTDD--CDA-NALC 163 Score = 39.5 bits (88), Expect = 0.003 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D+DEC + +C LC N PG Y+C Sbjct: 226 CQDIDECTNETDDCDANALCTNVPGLYVC 254 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 D+DEC + +C LC N PG Y+C G + + C D D Sbjct: 146 DIDECTNKTDDCDANALCTNVPGLYVCRCLKG--FEGDGKTCIDVD 189 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 95 ECEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 EC C G+Q +G+TC D+DEC + CD C N Sbjct: 48 ECV-CMPGFQGDGFTCEDIDECTNKTDDCDANALCTN 83 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 5/69 (7%) Frame = +2 Query: 11 GSASTCVTLRSPAARERRCMPKS----TSPYYECEGCPSGYQWNGYTCVDMDEC-DLIRP 175 G TC+ + A C ++ T + C C GY +G TC D+DEC + Sbjct: 180 GDGKTCIDVDECAGGTEMCALEASCLNTLGSFRCN-CMEGYTGDGKTCQDIDECTNETDD 238 Query: 176 CDDLVSCRN 202 CD C N Sbjct: 239 CDANALCTN 247 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDEC 160 Y C C G++ +G TC+D+DEC Sbjct: 88 YVCR-CLKGFEGDGKTCIDVDEC 109 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDEC 160 Y C C G++ +G TC+D+DEC Sbjct: 170 YVCR-CLKGFEGDGKTCIDVDEC 191 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/69 (28%), Positives = 28/69 (40%), Gaps = 5/69 (7%) Frame = +2 Query: 11 GSASTCVTLRSPAARERRCMPKS----TSPYYECEGCPSGYQWNGYTCVDMDEC-DLIRP 175 G TC+ + A C ++ T + C C GY +G T D+DEC + Sbjct: 98 GDGKTCIDVDECAGGTAMCALEASCLNTLGSFRCN-CMEGYTGDGKTSQDIDECTNKTDD 156 Query: 176 CDDLVSCRN 202 CD C N Sbjct: 157 CDANALCTN 165 >SB_35900| Best HMM Match : EGF_CA (HMM E-Value=2.5e-38) Length = 839 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C+DVDECADG A C C+NT GS+ C Sbjct: 796 CLDVDECADGTAMCALKASCLNTLGSFRC 824 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 G E +C D++EC +G+ +C C+N PGSY C G + + C D D Sbjct: 747 GFEGNGFNCADINECDNGKNDCHGNARCINAPGSYDCKCNKG--FKGDGKTCLDVD 800 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECD 163 C+ S R +C+ T ++CE C G++ NG+ C D++ECD Sbjct: 720 CLLGSSKCDRMAKCI--DTLSGFKCE-CNKGFEGNGFNCADINECD 762 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 Y+C+ C G++ +G TC+D+DEC D C SC N Sbjct: 781 YDCK-CNKGFKGDGKTCLDVDECADGTAMCALKASCLN 817 >SB_4874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/42 (47%), Positives = 23/42 (54%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 G+ G R + CVD+DEC G A C CVNT GSY C Sbjct: 162 GYENRGR-RDSDKCVDIDECGSGAARC--DHKCVNTEGSYHC 200 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYIC 381 VD +EC R C RLC NT GSY C Sbjct: 132 VDDNECE--RPVCSFPRLCRNTLGSYAC 157 >SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) Length = 3094 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C+DVDECADG A C C+NT GS+ C Sbjct: 3051 CLDVDECADGTAMCALKASCLNTLGSFRC 3079 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 G E +C D++EC +G+ +C C+N PGSY C G + + C D D Sbjct: 3002 GFEGNGFNCADINECDNGKNDCHGNARCINAPGSYDCKCNKG--FKGDGKTCLDVD 3055 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECD 163 C+ S R +C+ T ++CE C G++ NG+ C D++ECD Sbjct: 2975 CLLGSSKCDRMAKCI--DTLSGFKCE-CNKGFEGNGFNCADINECD 3017 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 Y+C+ C G++ +G TC+D+DEC D C SC N Sbjct: 3036 YDCK-CNKGFKGDGKTCLDVDECADGTAMCALKASCLN 3072 >SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 3312 Score = 41.9 bits (94), Expect = 6e-04 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 1/97 (1%) Frame = +1 Query: 295 CVDVDECADGRAN-CPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYC 471 C D+DEC N CP GR C+N PGSY C C Y+V D ++ + D + C Sbjct: 388 CQDIDECLSTSTNKCP-GR-CINRPGSYTC-DCPRGYFV-----LHDEENGHRCVDINEC 439 Query: 472 RRFNAVCGFGQKSFVIPVGLATAQCADWTEI*TDIRT 582 +R N C + + +G +C D ++ + RT Sbjct: 440 KRNNGWC---EHECINIIGTYRCRCRDGYKLEPNRRT 473 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 8/56 (14%) Frame = +1 Query: 295 CVDVDECAD--GRANCPRGR------LCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C+DVDEC + R C + C+NT GSY C G+ + T C D D Sbjct: 338 CIDVDECTEMSPRCRCANQKSASCNATCINTLGSYRCTCAKGYSLIGGT-VCQDID 392 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = +1 Query: 274 NERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 +E CVD++EC C C+N G+Y C G+ R C D D Sbjct: 426 DEENGHRCVDINECKRNNGWCEHE--CINIIGTYRCRCRDGYKLEPNRRTCQDLD 478 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 C D+DEC G C C NT GSY C G + + C Sbjct: 577 CEDIDECDTGLHKCE--HQCNNTFGSYSCSCSPGFALADDKKSC 618 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +2 Query: 92 YECEGCPSGYQW--NGYTCVDMDECDLIRPCDDLVSCRN 202 Y C C GY+ N TC D+DEC L C+ L C N Sbjct: 457 YRCR-CRDGYKLEPNRRTCQDLDECALFSGCEML--CHN 492 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 5/38 (13%) Frame = +2 Query: 62 RCMPKSTSPYYECEGCPSGY-----QWNGYTCVDMDEC 160 RC+ + S Y C+ CP GY + NG+ CVD++EC Sbjct: 405 RCINRPGS--YTCD-CPRGYFVLHDEENGHRCVDINEC 439 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = +1 Query: 277 ERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 E R C D+DECA + C LC NT GSY C Sbjct: 468 EPNRRTCQDLDECA-LFSGCE--MLCHNTRGSYYC 499 >SB_18281| Best HMM Match : EGF_CA (HMM E-Value=5.9e-11) Length = 43 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/39 (46%), Positives = 21/39 (53%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 D+DEC + CP R CVN GSY C G+ VN T Sbjct: 2 DIDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLVNNT 40 >SB_57080| Best HMM Match : EGF_CA (HMM E-Value=1.4013e-43) Length = 360 Score = 41.9 bits (94), Expect = 6e-04 Identities = 24/69 (34%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = +1 Query: 289 EHC-VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPS 465 +HC D +ECADG C C NT GS+ C G Y C D + D S Sbjct: 141 KHCETDTNECADGSHTCSINAACTNTVGSFTCACNAG--YTGNGHTCQDTNEC---ADGS 195 Query: 466 YCRRFNAVC 492 + NA C Sbjct: 196 HTCSINAAC 204 Score = 41.9 bits (94), Expect = 6e-04 Identities = 23/66 (34%), Positives = 27/66 (40%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCR 474 C D +ECADG C C NT GS+ C G Y C D + D S+ Sbjct: 185 CQDTNECADGSHTCSINAACTNTVGSFTCACNAG--YTGNGHTCQDTNEC---ADGSHTC 239 Query: 475 RFNAVC 492 NA C Sbjct: 240 SINAAC 245 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 C D +ECADG C C NT GS+ C C Y N Sbjct: 226 CQDTNECADGSHTCSINAACTNTVGSFTCA-CNAGYTGN 263 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 C +GY NG+TC D +EC D C +C N Sbjct: 174 CNAGYTGNGHTCQDTNECADGSHTCSINAACTN 206 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 C +GY NG+TC D +EC D C +C N Sbjct: 215 CNAGYTGNGHTCQDTNECADGSHTCSINAACTN 247 >SB_25669| Best HMM Match : LRR_1 (HMM E-Value=9.1e-33) Length = 1065 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +2 Query: 95 ECEGCPSGYQWNGYTCVDMDECDLIRPCDDL-VSCRN 202 EC C SGY +G TC D+DECD+ CD L +C N Sbjct: 458 ECV-CKSGYHGDGVTCEDIDECDIAHHCDKLHATCIN 493 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 295 CVDVDECADGRANCPR-GRLCVNTPGSYIC 381 C D+DEC D +C + C+NTPGS+ C Sbjct: 472 CEDIDEC-DIAHHCDKLHATCINTPGSHTC 500 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 C++ +EC C LC + GSY+C C Y Sbjct: 518 CINENECLRDSGICGTHALCSDLEGSYLCT-CEDQY 552 >SB_6742| Best HMM Match : EGF_CA (HMM E-Value=5.40004e-41) Length = 653 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/46 (45%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +2 Query: 74 KSTSPYYECEGCPSGYQWNGYT--CVDMDECDLIRPCDDLVSCRNE 205 K+T Y+C+ CP GY N CVD DEC PC CRNE Sbjct: 470 KNTLGSYKCQ-CPLGYSMNNEMKKCVDRDECAEDWPCSKFAFCRNE 514 Score = 35.9 bits (79), Expect = 0.037 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 3/69 (4%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN---TTRPCFDPDSLVKRCDPS 465 C DVDEC C + C NT GSY C G+ + + + C D D ++ Sbjct: 402 CTDVDECKTNAHEC-KNAFCHNTLGSYKCSCKEGYTFKDKDPVQKQCVDMDECEEQEYRK 460 Query: 466 YCRRFNAVC 492 C +A C Sbjct: 461 LCEMMDANC 469 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = +1 Query: 286 REHCVDVDECADG--RANCPR-GRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 ++ CVD+DEC + R C C NT GSY C G+ N + C D D Sbjct: 444 QKQCVDMDECEEQEYRKLCEMMDANCKNTLGSYKCQCPLGYSMNNEMKKCVDRD 497 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 62 RCMPKSTSPYYECEGCPSGYQWNGYTCVDMDEC 160 +CM + ++EC GY W C D+DEC Sbjct: 378 KCMNRDG--FFECMCKADGYVWYENECTDVDEC 408 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 274 NERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 NE ++ CVD DECA+ C + C N G+Y C Sbjct: 488 NEMKK--CVDRDECAEDWP-CSKFAFCRNEIGTYRC 520 >SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5445 Score = 41.5 bits (93), Expect = 8e-04 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYY-VNTTRPC 426 C D+DEC NC +C++ PG + C C YY N T+ C Sbjct: 1389 CRDIDECLTSSPNCTEKEVCIDLPGGFKCA-CKPEYYGENCTKAC 1432 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 C+D DEC C G CVNT + C+ G Y Sbjct: 5406 CIDRDECIGNP--CFNGAKCVNTASGFTCMCAPGFY 5439 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 GW G E R + C +G A C G +C NTP SY C G + Sbjct: 4427 GWTGVNCEIR-DFCALAS--VNGPA-CFNGGVCTNTPTSYTCTCARGFH 4471 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 D DEC C G C NT GS+IC Sbjct: 39 DFDECTKP-GWCQNGGTCQNTNGSFIC 64 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 DVDEC C LC+NT GS+ C Sbjct: 4784 DVDECY--HMLCKNDALCINTLGSFKC 4808 >SB_38887| Best HMM Match : EGF_CA (HMM E-Value=6.2e-31) Length = 131 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/55 (40%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +1 Query: 268 TGNERRREHCVDVDECADGRANC--PRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 TG C DV+EC +G ANC C+NT GSY C G+ Y R C Sbjct: 75 TGYHGDGYQCHDVNECQEGLANCGDDTKSQCINTVGSYKCSCNTGYQYQGNERVC 129 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +1 Query: 265 GTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 G + ++ C+DVDEC G NC C+N Y C G++ Sbjct: 33 GLAWDEKKRKCIDVDECMTGTHNCSTTAECLNIVSGYTCTCKTGYH 78 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +1 Query: 307 DECADGRANCPRG--RLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 DEC + CP LC NT GSY C G + R C D D Sbjct: 3 DECTNSTI-CPDSDRMLCTNTVGSYTCSCDTGLAWDEKKRKCIDVD 47 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDEC 160 Y C C +GY +GY C D++EC Sbjct: 69 YTCT-CKTGYHGDGYQCHDVNEC 90 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/56 (35%), Positives = 29/56 (51%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPS 465 +D+DEC + + C G++C+NT GS+ CV G Y + C LV D S Sbjct: 3615 IDIDECKNS-STCDSGKVCINTYGSHACVCNGDKYGPHCNYTCKSDIDLVFAIDGS 3669 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 289 EHCVD-VDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTR 420 E+C ++ECA+ A CP R+C+N G Y+C G Y N T+ Sbjct: 893 ENCTTYINECANSSA-CPADRVCINYGGGYLCGCPAGFYGPNCTK 936 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = +1 Query: 283 RREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 R + C DVDEC + C G C+N PG Y C C Y Sbjct: 2568 REKVCEDVDECFNDP--CTNGGACINLPGDYEC-DCPNKY 2604 Score = 31.5 bits (68), Expect = 0.80 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 289 EHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 ++C D+DEC + C G C N G Y C G+ Sbjct: 370 DNCADIDECTN--KPCLNGGSCTNLQGDYRCSCVSGY 404 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICV 384 G+ GT E+ D+DECA G +C NT GSY C+ Sbjct: 2823 GFNGTNCEK------DIDECATGNPCTGVANVCHNTYGSYECM 2859 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +1 Query: 289 EHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 + C+D DEC + C G C N G Y C G N C Sbjct: 1863 DKCIDFDECLN--KPCLNGGSCFNMDGEYRCKCAKGFCGKNCNSKC 1906 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICV 384 +DVDEC + C + + C+N+ GS+ CV Sbjct: 4765 LDVDECKS--SPCNKNQNCINSFGSFTCV 4791 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICV 384 C+DV+EC C G C N GS+ C+ Sbjct: 3353 CLDVNECDASPGPCVHGE-CSNNYGSFKCI 3381 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 C D+DEC N GR C+N GSY C G+ + N++R C D Sbjct: 2102 CQDIDECLSTSTNTCPGR-CINRLGSYTCDCPRGYTFDNSSRRCID 2146 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +1 Query: 262 RGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTR 420 RG + C+D++EC C C+N G+Y C C Y ++ R Sbjct: 2133 RGYTFDNSSRRCIDINECERNNGWCEHD--CINILGTYRC-RCRDGYKLDPNR 2182 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 6/53 (11%) Frame = +1 Query: 298 VDVDECADGRANCPR------GRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 +D DECA C C+NT GS++C C Y + C D D Sbjct: 2055 LDFDECAMSPCRCANQNNFGCNATCINTAGSFVC-KCSKGYTLIRGTICQDID 2106 >SB_21285| Best HMM Match : EGF_CA (HMM E-Value=1.3e-37) Length = 517 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/89 (32%), Positives = 42/89 (47%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 G+ G G E C DVDECA NC +C+NT GS+ C C ++ N C D Sbjct: 329 GFTGDGYE-----CNDVDECAHALHNCHTHAICINTVGSFNC-SCEAGFHGNGI-DCKDI 381 Query: 436 DSLVKRCDPSYCRRFNAVCGFGQKSFVIP 522 + +++ S+ R ++C SF P Sbjct: 382 NECMEK---SHDCRTGSICINKHGSFTCP 407 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 Y C C G+ +GY C D+DEC + C C N Sbjct: 322 YTCT-CNVGFTGDGYECNDVDECAHALHNCHTHAICIN 358 >SB_39808| Best HMM Match : EGF_CA (HMM E-Value=6.3e-35) Length = 850 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/48 (39%), Positives = 24/48 (50%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C D+DEC D C + C NTPGSY C G+ + + C D D Sbjct: 284 CSDIDECLDDAHLCDQR--CTNTPGSYACGCYHGYSLSSDMKTCIDID 329 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 C+D+DEC C +LC NT G Y C G+ N R C Sbjct: 325 CIDIDECTMTSHGC--SQLCNNTLGGYNCYCLSGYSLGNDNRTC 366 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 D++EC + C + +CVNT GS+ C G+ N ++ C D D Sbjct: 245 DLNECEIRKHTCDQ--VCVNTIGSFRCGCNVGYTLRNDSKTCSDID 288 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +2 Query: 56 ERRCMPKSTSPYYECEGCPSGYQWNG--YTCVDMDECDLI-RPCDDLVSCRN 202 ++RC +T Y C GC GY + TC+D+DEC + C L C N Sbjct: 298 DQRCT--NTPGSYAC-GCYHGYSLSSDMKTCIDIDECTMTSHGCSQL--CNN 344 >SB_28600| Best HMM Match : EGF_CA (HMM E-Value=4.2e-40) Length = 1042 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/49 (42%), Positives = 24/49 (48%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 PG+ G G +C DVDEC G +C C NT GSY C GH Sbjct: 788 PGFTGNGF-----NCTDVDECTMGTHSCHANAQCDNTIGSYTCRCNNGH 831 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/65 (40%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = +1 Query: 301 DVDECADGRANCPRG-RLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRR 477 D +EC++G C CVNTPGSY CV C Y V+ + C D V C S Sbjct: 717 DYNECSEGTDECDHTLATCVNTPGSYACV-CPAGYTVSGYQ-CND----VNECGASDRCH 770 Query: 478 FNAVC 492 NA C Sbjct: 771 VNATC 775 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSCRN 202 +T Y C CP+GY +GY C D++EC C +C N Sbjct: 737 NTPGSYACV-CPAGYTVSGYQCNDVNECGASDRCHVNATCTN 777 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 Y C C G+ NG+ C D+DEC + C C N Sbjct: 782 YIC-ACKPGFTGNGFNCTDVDECTMGTHSCHANAQCDN 818 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C DV+EC C C NT GSYIC Sbjct: 757 CNDVNECG-ASDRCHVNATCTNTIGSYIC 784 >SB_13123| Best HMM Match : EGF_CA (HMM E-Value=4.9e-22) Length = 89 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/54 (40%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPC-GGHYYVNTTRPCFDPDSLVKRCDP 462 V+EC+ G A C C+NT GSY CV C G VN C D D + P Sbjct: 2 VNECSTGAARCQANAYCMNTDGSYRCVTCPSGTRVVN--NKCADIDECTEGSYP 53 Score = 35.9 bits (79), Expect = 0.037 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D+DEC +G C + C N GSY C Sbjct: 41 CADIDECTEGSYPCAADQTCQNVFGSYRC 69 Score = 33.9 bits (74), Expect = 0.15 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 C T + CM +T Y C CPSG + C D+DEC + PC +C+N Sbjct: 5 CSTGAARCQANAYCM--NTDGSYRCVTCPSGTRVVNNKCADIDECTEGSYPCAADQTCQN 62 >SB_19665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 491 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/69 (39%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = +1 Query: 289 EHCVDVDECA-DGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPS 465 E C D+DECA G + C + C NT GSY C G Y + C D D D S Sbjct: 158 EKCSDIDECAVSGDSPCDKNAECNNTVGSYTCTCKPG--YTGDRKTCNDIDECAISGD-S 214 Query: 466 YCRRFNAVC 492 C + NA C Sbjct: 215 PCDK-NAEC 222 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 286 REHCVDVDECA-DGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 R+ C D+DECA G + C + C NT GSY C G Y + C D Sbjct: 199 RKTCNDIDECAISGDSPCDKNAECNNTVGSYTCTCNPG--YTGDGKTCDD 246 Score = 35.5 bits (78), Expect = 0.049 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +2 Query: 41 SPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDLI--RPCDDLVSCRN 202 SP + C +T Y C C GY + TC D+DEC + PCD C N Sbjct: 172 SPCDKNAEC--NNTVGSYTCT-CKPGYTGDRKTCNDIDECAISGDSPCDKNAECNN 224 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 41 SPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDEC 160 SP + C +T Y C C GY +G TC D++EC Sbjct: 214 SPCDKNAEC--NNTVGSYTCT-CNPGYTGDGKTCDDVNEC 250 >SB_13199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 CVD+DECA+G+ +C + C NT G Y C G+ Sbjct: 138 CVDIDECAEGKDDC--SQTCANTHGEYECACVDGY 170 >SB_47465| Best HMM Match : EGF_CA (HMM E-Value=2.4e-08) Length = 263 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 G R E CVD+DEC R C C+NT GSY+C Sbjct: 143 GFVREPEGCVDIDECVYPRV-CSEHAKCINTHGSYLC 178 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 98 CEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSCRN 202 CE C G+ CVD+DEC R C + C N Sbjct: 138 CE-CKKGFVREPEGCVDIDECVYPRVCSEHAKCIN 171 >SB_5000| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1050 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCP--RGRLCVNTPGSYIC 381 PG++ +E+ C DVDEC + CP G C+NT GSYIC Sbjct: 767 PGYKLMSDEKT---CQDVDECENAAQLCPLDMGLQCMNTKGSYIC 808 Score = 36.7 bits (81), Expect = 0.021 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 295 CVDVDECAD-GRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYC 471 C D++ECAD NCP+ C NT G Y C G+ N R C S + D + C Sbjct: 415 CADINECADPADNNCPQE--CENTLGGYKCKCRPGYISSNNGRICTVVTSSMNPLDINEC 472 Score = 33.9 bits (74), Expect = 0.15 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 74 KSTSPYYECEGCPSGYQWNGYTCVDMDEC 160 KS Y C CPSG +G +C D++EC Sbjct: 393 KSEELGYTCGACPSGRTGDGVSCADINEC 421 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 5/47 (10%) Frame = +2 Query: 77 STSPYYECEGCPSGYQW--NGYTCVDMDECD---LIRPCDDLVSCRN 202 +T +Y C GCP GY+ + TC D+DEC+ + P D + C N Sbjct: 756 NTVGFYNC-GCPPGYKLMSDEKTCQDVDECENAAQLCPLDMGLQCMN 801 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 +D+DEC+ C C+NT G Y C G+ ++ + C D D Sbjct: 738 LDIDECSRKTHKCSDS--CLNTVGFYNCGCPPGYKLMSDEKTCQDVD 782 >SB_37317| Best HMM Match : EGF_CA (HMM E-Value=6.6e-25) Length = 86 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/33 (54%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +1 Query: 289 EHCV-DVDECADGRANC-PRGRLCVNTPGSYIC 381 E CV D+DEC+ G C P G C NT GSY C Sbjct: 39 ETCVEDIDECSSGAHTCAPSGSTCTNTVGSYTC 71 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 304 VDECADGRANC-PRGRLCVNTPGSYICVPCGGHY 402 +DEC+DG C P G C N GS+ C C Y Sbjct: 2 IDECSDGTNTCAPIGSSCTNNAGSFTC-SCNAGY 34 >SB_55657| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 868 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCP--RGRLCVNTPGSYIC 381 PG++ +E+ C DVDEC + CP G C+NT GSY+C Sbjct: 542 PGYKLMSDEKT---CQDVDECENAAQLCPPDMGLQCMNTKGSYVC 583 Score = 36.7 bits (81), Expect = 0.021 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 295 CVDVDECAD-GRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYC 471 C D++ECAD NCP+ C NT G Y C G+ N R C S + D + C Sbjct: 241 CADINECADPADNNCPQE--CENTLGGYKCKCRPGYISSNNGRICTVVTSSMNPLDINEC 298 Score = 33.9 bits (74), Expect = 0.15 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 74 KSTSPYYECEGCPSGYQWNGYTCVDMDEC 160 KS Y C CPSG +G +C D++EC Sbjct: 219 KSEELGYTCGACPSGRTGDGVSCADINEC 247 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = +2 Query: 77 STSPYYECEGCPSGYQW--NGYTCVDMDECD 163 +T +Y C GCP GY+ + TC D+DEC+ Sbjct: 531 NTVGFYNC-GCPPGYKLMSDEKTCQDVDECE 560 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 +D+DEC+ C C+NT G Y C G+ ++ + C D D Sbjct: 513 LDIDECSRKTHKCSDS--CLNTVGFYNCGCPPGYKLMSDEKTCQDVD 557 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 D++EC + +C ++C NT GSY C G N + C D Sbjct: 353 DINEC-NYPNDC--SQMCSNTAGSYKCSCVNGFVLSNDLKTCAD 393 >SB_46351| Best HMM Match : EGF_CA (HMM E-Value=2.3e-14) Length = 58 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 D+DECA G A CP CVN GSY C Sbjct: 17 DIDECALGVATCPASADCVNNDGSYTC 43 >SB_7361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/49 (40%), Positives = 24/49 (48%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 PG+ G G +C D+DEC G +C C NT GSY C GH Sbjct: 417 PGFTGNGF-----NCTDIDECTLGTHSCHANAQCRNTIGSYTCRCNNGH 460 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 Y C C G+ NG+ C D+DEC L C CRN Sbjct: 411 YTCI-CNPGFTGNGFNCTDIDECTLGTHSCHANAQCRN 447 >SB_55950| Best HMM Match : EGF_CA (HMM E-Value=2.7e-08) Length = 42 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 +DEC + CP R CVN GSY C G+ VN T Sbjct: 2 IDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLVNNT 39 >SB_34822| Best HMM Match : EGF_CA (HMM E-Value=8.9e-09) Length = 87 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +1 Query: 286 REHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNT 414 + HC D DECA C + LC+N PG Y C C G Y +++ Sbjct: 40 QRHCADHDECATRNNTCEQ--LCLNHPGHYTC-DCRGGYELDS 79 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +1 Query: 304 VDECA--DGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKR 453 +DECA +G + R C NT GSY C G+ + R C D D R Sbjct: 2 IDECAVNNGTTHGCEYR-CNNTQGSYKCSCQQGYLLTSDQRHCADHDECATR 52 >SB_44376| Best HMM Match : EGF_CA (HMM E-Value=7.8e-22) Length = 84 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +1 Query: 292 HCVDVDECAD-GRANCPRGRLCVNTPGSYIC 381 +C DVDEC+ G A C C+NTPGS+ C Sbjct: 39 NCTDVDECSTPGVATCSNLATCINTPGSFKC 69 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +2 Query: 41 SPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL--IRPCDDLVSCRN 202 SP +C+ S Y C GC G+ +G C D+DEC + C +L +C N Sbjct: 10 SPCDPNAKCINMMGS--YAC-GCNEGFLGDGTNCTDVDECSTPGVATCSNLATCIN 62 >SB_24529| Best HMM Match : Lectin_C (HMM E-Value=3.4e-27) Length = 644 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/65 (40%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = +1 Query: 301 DVDECADGRANCPRG-RLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRR 477 D +EC++G C CVNTPGSY C C Y V+ R C D V C S Sbjct: 374 DYNECSEGTDECDHTLATCVNTPGSYTCA-CPAGYTVSGHR-CND----VNECGVSDRCH 427 Query: 478 FNAVC 492 NA C Sbjct: 428 VNATC 432 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSCRN 202 +T Y C CP+GY +G+ C D++EC + C +C N Sbjct: 394 NTPGSYTC-ACPAGYTVSGHRCNDVNECGVSDRCHVNATCAN 434 >SB_55021| Best HMM Match : EGF_CA (HMM E-Value=1.4013e-45) Length = 348 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 301 DVDECADGRANCPRGRL-CVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 D+DEC+ C C+NTPGSY C G Y + T C D D Sbjct: 109 DIDECSGSNDVCKDSNARCINTPGSYKCECPSGMSYNHGTGTCEDKD 155 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C D DEC C C NT GSY C C Y + C D D Sbjct: 12 CADRDECQSLPNACTSNAACSNTVGSYYC-RCNIGYRGDGRIKCDDVD 58 >SB_26480| Best HMM Match : EGF (HMM E-Value=0) Length = 1772 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/47 (40%), Positives = 25/47 (53%) Frame = +1 Query: 259 WRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 W GT + C D +EC+ G C +LC+NTPGSY C G+ Sbjct: 1724 WTGT-----QPRCEDQNECSVGNHRC--AQLCINTPGSYNCACAKGY 1763 >SB_19340| Best HMM Match : EGF_CA (HMM E-Value=3.8e-27) Length = 888 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/64 (34%), Positives = 26/64 (40%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRRF 480 D +ECADG C C NT GS+ C G Y C D + D S+ Sbjct: 680 DTNECADGSHTCSINAACTNTVGSFTCACNAG--YTGNGHTCQDTNECT---DGSHTCSI 734 Query: 481 NAVC 492 NA C Sbjct: 735 NAAC 738 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 C D +EC DG C C NT GS+ C C Y N Sbjct: 719 CQDTNECTDGSHTCSINAACTNTVGSFTCA-CNAGYTGN 756 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 C +GY NG+TC D +EC D C +C N Sbjct: 708 CNAGYTGNGHTCQDTNECTDGSHTCSINAACTN 740 >SB_15408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/62 (40%), Positives = 27/62 (43%) Frame = +1 Query: 283 RREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDP 462 R CVD +EC C GR CVNT GSY C C Y +P D V RC Sbjct: 295 RDNKCVDKNECEADSTLCTNGR-CVNTEGSYKCT-CNNGY-----KPSPDGKRCVGRCGR 347 Query: 463 SY 468 Y Sbjct: 348 VY 349 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = +1 Query: 286 REHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 R CVD++EC C G +C NT GSY C+ C Y N Sbjct: 443 RTQCVDINECLTQGEMCRNG-VCENTEGSYRCI-CNAGYAAN 482 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C DVDEC C GR CVNT G Y C Sbjct: 129 CEDVDECKTITNICANGR-CVNTNGGYRC 156 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/47 (44%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCG-GHYYVNTTRPCFDPD 438 D+DEC C RG CVNT GS+ C CG G T C D D Sbjct: 89 DIDECRAIPRVC-RGGKCVNTVGSFKC-DCGAGRTMDPVTNKCEDVD 133 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTR 420 +VDEC CP GR C++ P + CV C Y + T R Sbjct: 258 EVDECRMDANACPNGR-CIDMPSGFRCV-CNDGYILPTGR 295 >SB_41711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1662 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 C D+DEC + R C G C NT GS+ C G Y Sbjct: 1487 CQDIDECTERRNPCRAGTTCKNTIGSFTCECPTGRY 1522 >SB_58994| Best HMM Match : EGF_CA (HMM E-Value=2.3e-29) Length = 309 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 G+ T N+R CVD++EC G+ C G C+NT GSY C Sbjct: 201 GYHLTDNKRT---CVDMNECILGKGLCGNG-TCINTEGSYRC 238 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLV 447 D+DEC C G +C N GS+ CV G++ + R C D + + Sbjct: 172 DMDECGTP-GYCDHG-MCKNMNGSFSCVCNQGYHLTDNKRTCVDMNECI 218 >SB_45954| Best HMM Match : VWA (HMM E-Value=4e-26) Length = 715 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT 417 +D++ECA A CP GR C N G + C+ G Y +N T Sbjct: 453 IDINECAAVDA-CPSGRSCANYHGGFSCICQEGFYGINCT 491 >SB_20531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 38.3 bits (85), Expect = 0.007 Identities = 26/87 (29%), Positives = 35/87 (40%), Gaps = 1/87 (1%) Frame = +1 Query: 295 CVDVDECADGRANCP-RGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYC 471 CVD DEC + C G +C NT GSY C C Y + P +++ P C Sbjct: 161 CVDNDECTEDTHRCAIEGAICTNTEGSYYCT-CQRGYTGDGFTCTATPRAIL---SPMSC 216 Query: 472 RRFNAVCGFGQKSFVIPVGLATAQCAD 552 C G + V +A C+D Sbjct: 217 SEEEFPCASGDCVPLTSVCDGSADCSD 243 >SB_18415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 623 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICV 384 CVDV+EC R C R + C+NT GSY CV Sbjct: 496 CVDVNECR--RNPCSRSQRCINTRGSYRCV 523 >SB_45136| Best HMM Match : EGF_CA (HMM E-Value=8.7e-36) Length = 123 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D+DEC G NC C NT GS+ C Sbjct: 80 CQDIDECRKGTHNCHSDANCTNTKGSFFC 108 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 D++EC G NC C+NT GS+ C C Y N Sbjct: 41 DINECEVGSHNCHADATCINTDGSFTCA-CNVGYAGN 76 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Frame = +1 Query: 304 VDECA----DGRANCPRGRLCVNTPGSYIC 381 +DEC R NC R C NT GS+ C Sbjct: 2 IDECTTTSLQHRDNCHRNATCANTHGSFTC 31 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSCRN 202 +T + C C GY NG C D+DEC C +C N Sbjct: 60 NTDGSFTC-ACNVGYAGNGAFCQDIDECRKGTHNCHSDANCTN 101 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICV 384 D+DEC D R C R+CVNT GSY CV Sbjct: 452 DIDECLDSRI-CAVERMCVNTYGSYQCV 478 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 DVDEC + C ++CVNT G Y C G+Y N T C Sbjct: 1667 DVDECKSNNS-CSADQMCVNTYGGYKCSCKTGYYGENCTLAC 1707 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = +1 Query: 283 RREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 R + C+DVDEC C G C N GSY C C +Y Sbjct: 883 RDQICLDVDECKT-LFPCLHGGSCENVAGSYRC-SCTANY 920 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 DVDEC+ + C G C+ G Y C H N + DP Sbjct: 191 DVDECSS--SPCQNGASCIKKVGRYFCECSTAHVGKNCHKNFTDP 233 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/57 (33%), Positives = 24/57 (42%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 GW G E R + C +G A C G +C NTP SY C G + + C Sbjct: 2643 GWTGVNCEIR-DFCALAS--VNGPA-CFNGGVCTNTPTSYTCTCARGFHGLRCEGGC 2695 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 D+DEC C G CVN G+Y C Sbjct: 1444 DIDECQPSNP-CYNGGTCVNEEGAYSC 1469 >SB_13997| Best HMM Match : EGF_CA (HMM E-Value=1.2e-05) Length = 770 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCG 393 DVDEC CP CVNT GSY C G Sbjct: 406 DVDECNGSSHGCPSSASCVNTHGSYYCTGYG 436 >SB_32816| Best HMM Match : EGF_CA (HMM E-Value=3.1e-11) Length = 84 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/44 (43%), Positives = 22/44 (50%) Frame = +1 Query: 307 DECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 DEC C + CVNTPGSY+C G Y T+ C D D Sbjct: 3 DECMMTPNLCGEAK-CVNTPGSYVCKCNSGFEYNPQTKTCGDKD 45 >SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) Length = 407 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 C D++EC R C G++C N+ GSY C G+ R C Sbjct: 364 CTDINECGYNRGGC--GQICTNSLGSYNCSCLNGYVLNEDLRTC 405 >SB_15082| Best HMM Match : EGF_CA (HMM E-Value=5.5e-12) Length = 125 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 PG+RG G+ C D+DEC + C C NT GS+ C Sbjct: 29 PGYRGNGHL-----CSDIDECGENVHACSPNATCTNTVGSFSC 66 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDEC-DLIRPCDDLVSCRN 202 Y C C GY+ NG+ C D+DEC + + C +C N Sbjct: 23 YACV-CNPGYRGNGHLCSDIDECGENVHACSPNATCTN 59 >SB_11375| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 651 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +1 Query: 295 CVDVDECAD-GRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C D+DEC + + + G+ C+N PG Y C G + R C D D Sbjct: 181 CRDIDECEELKKTSLSCGQRCLNFPGGYNCTCNSGFILIPDNRTCNDTD 229 Score = 37.1 bits (82), Expect = 0.016 Identities = 21/64 (32%), Positives = 26/64 (40%), Gaps = 1/64 (1%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSL-VKRCDPSYC 471 C D++EC NC CVN G + C G+ C D D K CD + C Sbjct: 101 CADINECVTSNGNC--SHTCVNWEGGFNCTCAEGYALTYGGYECVDIDECSSKPCDHT-C 157 Query: 472 RRFN 483 R N Sbjct: 158 RNTN 161 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +2 Query: 107 CPSGYQ--WNGYTCVDMDECDLIRPCDDLVSCRN 202 C GY + GY CVD+DEC +PCD +CRN Sbjct: 129 CAEGYALTYGGYECVDIDECS-SKPCDH--TCRN 159 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/52 (36%), Positives = 23/52 (44%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVK 450 C D DEC G +NC +LC NT G Y C G+ C D D + Sbjct: 265 CSDKDECKTG-SNC--SQLCTNTAGGYQCSCHHGYVLSANQHACVDVDECAR 313 Score = 35.1 bits (77), Expect = 0.065 Identities = 20/55 (36%), Positives = 25/55 (45%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCD 459 CVDVDECA C C+N+PGSY C G + C + + K D Sbjct: 305 CVDVDECARVHG-CQDS--CLNSPGSYKCACSDGKLLAMDGKSCKEMVPVTKAID 356 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +2 Query: 77 STSPYYECEGCPSGY--QWNGYTCVDMDECDLIRPCDDLVSCRN 202 +T+ Y+C C GY N + CVD+DEC + C D SC N Sbjct: 283 NTAGGYQCS-CHHGYVLSANQHACVDVDECARVHGCQD--SCLN 323 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/51 (37%), Positives = 23/51 (45%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLV 447 CVD+DEC G A C C NT GS+ C G+ C D + V Sbjct: 61 CVDIDECKKG-AKCQYS--CTNTNGSFYCSCRHGYALQADNTTCADINECV 108 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 CVD+DEC+ P C NT GS++C G ++ C D D Sbjct: 142 CVDIDECSSK----PCDHTCRNTNGSFVCSCREGFRLLSDNTTCRDID 185 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/64 (31%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSY-C 471 C D+DEC C + C+NT GS C G+ C D D K Y C Sbjct: 20 CRDIDECKTNNGGC--SQRCLNTNGSRACACDAGYDLEADGVTCVDIDECKKGAKCQYSC 77 Query: 472 RRFN 483 N Sbjct: 78 TNTN 81 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/48 (37%), Positives = 21/48 (43%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPD 438 C D DEC D C + C N PGSY C G+ + C D D Sbjct: 225 CNDTDECLDSNT-CQQ--TCTNLPGSYRCSCYKGYELDLDGKTCSDKD 269 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +2 Query: 59 RRCMPKSTSPYYECEGCPSGY--QWNGYTCVDMDECDLIRPCDDLVSCRN 202 +RC+ +T+ C C +GY + +G TCVD+DEC C SC N Sbjct: 35 QRCL--NTNGSRAC-ACDAGYDLEADGVTCVDIDECKKGAKCQ--YSCTN 79 >SB_5376| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1705 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 CVD+DECA NC C NT GS+ C Sbjct: 1573 CVDIDECAIYTDNCHSDANCTNTKGSFYC 1601 Score = 35.9 bits (79), Expect = 0.037 Identities = 21/57 (36%), Positives = 27/57 (47%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPS 465 C++++EC G NC CVNT G + CV G Y T C D + CD S Sbjct: 821 CMELNECTLGLHNCHVDAFCVNTGGQFYCVCNLG--YSGTGVLCAD----INECDAS 871 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 CVD++EC NC C+N P ++ C C Y N T C D Sbjct: 140 CVDINECVLDWHNCHSDGYCINIPSTFTCA-CSVGYTGNGTN-CTD 183 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 D++EC G NC C+NT GS+ C C Y N Sbjct: 41 DINECEVGSHNCHADATCINTDGSFTCA-CNVGYAGN 76 Score = 31.5 bits (68), Expect = 0.80 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECD 163 C GY +G TCVD++ECD Sbjct: 710 CHVGYSGDGVTCVDINECD 728 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GY NG TCVD++EC Sbjct: 1512 CHVGYSGNGVTCVDINEC 1529 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECD 163 C +GY +G TCVD+ EC+ Sbjct: 1653 CHTGYSGDGVTCVDISECN 1671 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GY +G TC D+DEC Sbjct: 951 CHVGYSGDGVTCTDLDEC 968 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDLIRP-CDDLVSCRN 202 C GY G CVD+DEC + C +C N Sbjct: 1562 CQVGYSGYGVMCVDIDECAIYTDNCHSDANCTN 1594 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECD 163 C GY +G TCVD++EC+ Sbjct: 1312 CHVGYSGDGVTCVDINECN 1330 Score = 29.5 bits (63), Expect = 3.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C +GY NG C+D++EC Sbjct: 1362 CHTGYSGNGVICIDINEC 1379 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Frame = +1 Query: 304 VDECA----DGRANCPRGRLCVNTPGSYIC 381 +DEC R NC R C NT GS+ C Sbjct: 2 IDECTTTSLQHRDNCHRNATCANTHGSFTC 31 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GY +G TCVD++EC Sbjct: 270 CHVGYSGDGVTCVDINEC 287 Score = 29.1 bits (62), Expect = 4.3 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECD 163 C GY +G TC+D++EC+ Sbjct: 320 CHIGYSGDGVTCIDINECN 338 Score = 29.1 bits (62), Expect = 4.3 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECD 163 C GY +G C D+DEC+ Sbjct: 901 CEKGYSGDGVNCTDIDECN 919 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GY +G TCVD++EC Sbjct: 1112 CHVGYSGDGVTCVDINEC 1129 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDECD 163 +T + C C +GY +G CVD++EC+ Sbjct: 1203 NTKGSFHCT-CHTGYSGDGVICVDINECN 1230 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GY +G TCVD++EC Sbjct: 1603 CHVGYSGDGVTCVDINEC 1620 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDL 166 C +GY +G CVD++EC L Sbjct: 129 CKNGYSGDGTACVDINECVL 148 Score = 28.7 bits (61), Expect = 5.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDL 166 C GY NG C++++EC L Sbjct: 810 CHKGYSGNGVACMELNECTL 829 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDEC 160 C GY +G TCVD++EC Sbjct: 1262 CNVGYSGDGNTCVDINEC 1279 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECD 163 C +GY +G CVD++EC+ Sbjct: 370 CNTGYSGDGVICVDINECN 388 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECD 163 C GY +G TC+D++EC+ Sbjct: 610 CHVGYSGDGVTCLDINECN 628 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDEC 160 +T + C C GY +G +CVD++EC Sbjct: 1153 NTKGSFHCT-CHVGYSGDGVSCVDINEC 1179 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECD 163 C GY +G TCVD+ EC+ Sbjct: 1412 CHVGYSGDGVTCVDIVECN 1430 >SB_34419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 D+DECA G C C NT G Y C YY + C Sbjct: 154 DIDECASGSHKCQAKTTCNNTKGGYNCTCVSAMYYPVSPYKC 195 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 D+DEC+ + NC + C NT GS+ C C Y+ N Sbjct: 64 DIDECSTKKHNCSKYASCKNTAGSFTCA-CNAGYHGN 99 >SB_14925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 37.1 bits (82), Expect = 0.016 Identities = 22/64 (34%), Positives = 31/64 (48%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRRF 480 DVDEC+DG++ C C NT GS+ C G + C D + ++ P+ C Sbjct: 99 DVDECSDGQSPCHVSANCSNTLGSFTCTCKDG--FTGDGLTCKDVNECLR---PNAC-HV 152 Query: 481 NAVC 492 NA C Sbjct: 153 NATC 156 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/59 (28%), Positives = 25/59 (42%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSCRN 202 C +SP C +T + C C G+ +G TC D++EC C +C N Sbjct: 103 CSDGQSPCHVSANC--SNTLGSFTCT-CKDGFTGDGLTCKDVNECLRPNACHVNATCTN 158 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C DV+EC A C C NT GSY C Sbjct: 138 CKDVNECLRPNA-CHVNATCTNTIGSYNC 165 >SB_9772| Best HMM Match : EGF_CA (HMM E-Value=3.9e-25) Length = 83 Score = 37.1 bits (82), Expect = 0.016 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C D++EC G +C LC+N P S+IC Sbjct: 40 CQDINECEIGSHDCHSDALCINYPSSFIC 68 Score = 34.7 bits (76), Expect = 0.086 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 ++ECADG C C NT GS+ C G+ Sbjct: 2 INECADGSHTCSNKATCTNTVGSFTCACKAGY 33 Score = 30.7 bits (66), Expect = 1.4 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDL 166 C +GY +G+TC D++EC++ Sbjct: 29 CKAGYTGDGHTCQDINECEI 48 >SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2162 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 292 HCV-DVDECADGRANCPRGRLCVNTPGSYIC 381 HC D+DEC+ G C G C NTPG+Y C Sbjct: 726 HCEKDIDECSLGY--CKNGATCTNTPGNYSC 754 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/39 (48%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 298 VDVDECADGRAN-CPRGRLCVNTPGSYICVPCGGHYYVN 411 +D+DEC AN C C NT GSY CV C YY N Sbjct: 1811 LDIDECL---ANPCSSYGSCNNTIGSYECV-CKQGYYGN 1845 Score = 27.9 bits (59), Expect = 9.9 Identities = 21/71 (29%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC--FDPDSLVKRCDPSYC 471 VD++EC C G C N G+Y C G+ N DP+ + S C Sbjct: 353 VDINECKVQPGPCLNGGTCDNYLGTYGCSCKAGYRGKNCQENIDECDPNPCLNGA-TSRC 411 Query: 472 RRFNAVCGFGQ 504 R VC G+ Sbjct: 412 TRPAIVCAIGR 422 >SB_54230| Best HMM Match : EGF (HMM E-Value=0) Length = 1359 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 289 EHCV-DVDECADGRANCPRGRLCVNTPGSYICVPCGG 396 EHC DV+EC+ + C G C+N PG+Y C G Sbjct: 832 EHCEKDVNECSQN-SPCRNGATCLNLPGAYTCTCASG 867 Score = 33.9 bits (74), Expect = 0.15 Identities = 25/92 (27%), Positives = 32/92 (34%), Gaps = 3/92 (3%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRR 477 +DVDEC G C C N G+Y C G+ T + C + + C R Sbjct: 1016 IDVDECTPGNNPCKNRATCSNLHGTYTCTCATGY----TGKHC---EKDIDECKVQNPCR 1068 Query: 478 FNAVC--GFGQKSFVIPVGLATAQCAD-WTEI 564 A C G P G C WT + Sbjct: 1069 NGATCINSMGDYRCSCPPGFTGQHCEKAWTSV 1100 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 D+DEC ++C G C N G+Y C+ G+ Sbjct: 798 DIDECKI-TSSCKNGATCTNLHGTYTCICATGY 829 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 289 EHCV-DVDECADGRANCPRGRLCVNTPGSYICVPC 390 +HC D+DEC C G C+N+ G Y C C Sbjct: 871 KHCEKDIDECKVQNP-CRNGATCINSIGDYRCSCC 904 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +2 Query: 41 SPAARERRCMPKSTSPYYECEGCPSGYQWNGYTC-VDMDECDLIRPCDDLVSCRN 202 +P + C+ +T Y C CP+G G C D+DEC + C + +C N Sbjct: 767 NPCRNDGTCV--NTYGSYSC-ACPTGL--TGKNCETDIDECKITSSCKNGATCTN 816 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +1 Query: 292 HC-VDVDECADGRANCPRGRLCVNTPGSYICV-PCG 393 HC D++EC C CVNT GSY C P G Sbjct: 755 HCETDLNECKPSNP-CRNDGTCVNTYGSYSCACPTG 789 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/38 (28%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +1 Query: 289 EHCVD-VDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 +HC +++C C G C N G+Y C G+ Sbjct: 911 QHCEKGINKCIPSSNPCKNGATCSNLHGTYTCTYATGY 948 >SB_38403| Best HMM Match : PP2C (HMM E-Value=8.5e-35) Length = 916 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +1 Query: 286 REHCVDVDECAD-GRANCPRGRLCVNTPGSYICVPCGGHYYVNT-TRPC 426 + C D++EC D C + LC+N PG+Y C C Y +N+ R C Sbjct: 869 KTRCQDINECLDFSTTGCQQ--LCINDPGTYHCA-CHSGYTINSDNRTC 914 >SB_23241| Best HMM Match : EGF_CA (HMM E-Value=6.3e-30) Length = 200 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 PG+ G G +C D+DEC+ NC + +C NT S+ C Sbjct: 148 PGYTGDGI-----NCADIDECSLRSDNCHQDAICSNTAASFTC 185 Score = 35.9 bits (79), Expect = 0.037 Identities = 25/71 (35%), Positives = 32/71 (45%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRRF 480 DV+EC+ NC + CVNT GS+ C G Y C D D R D C + Sbjct: 118 DVNECSLENHNCHQDASCVNTIGSFACTCKPG--YTGDGINCADIDECSLRSD--NCHQ- 172 Query: 481 NAVCGFGQKSF 513 +A+C SF Sbjct: 173 DAICSNTAASF 183 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 107 CPSGYQWNGYTCVDMDECDL 166 C GY +G C D+DEC L Sbjct: 146 CKPGYTGDGINCADIDECSL 165 >SB_52863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +1 Query: 289 EHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 + C DV+EC G +C CVNT G+Y C+ C Y Sbjct: 31 DKCPDVNECRLGLDSCHYNSTCVNTYGTYHCI-CNPGY 67 >SB_13309| Best HMM Match : EGF (HMM E-Value=0) Length = 718 Score = 35.9 bits (79), Expect = 0.037 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 +DV+ECA C G +C N+PG Y C G+ Sbjct: 537 IDVNECASSNP-CKNGGVCTNSPGGYSCKCASGY 569 Score = 34.7 bits (76), Expect = 0.086 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 DV+ECA C G +C N+PG Y C G+ Sbjct: 382 DVNECASSNP-CKNGGVCTNSPGGYSCKCASGY 413 Score = 34.7 bits (76), Expect = 0.086 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 DV+ECA C G +C N+PG Y C G+ Sbjct: 421 DVNECASSNP-CKNGGVCTNSPGGYSCKCASGY 452 Score = 34.7 bits (76), Expect = 0.086 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 DV+ECA C G +C N+PG Y C G+ Sbjct: 460 DVNECASSNP-CKNGGVCTNSPGGYSCKCASGY 491 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 DV+ECA C G +C N+PG Y C G+ Sbjct: 499 DVNECASSNP-CKNGGVCANSPGRYSCECASGY 530 >SB_22873| Best HMM Match : EGF_CA (HMM E-Value=1.2e-14) Length = 434 Score = 35.9 bits (79), Expect = 0.037 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 D++ECADG C C NT GS+ C Sbjct: 323 DINECADGSHTCSNKATCTNTIGSFTC 349 >SB_20425| Best HMM Match : EGF_CA (HMM E-Value=1.2e-20) Length = 144 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC--VPC-GGHYYVNTTRPC 426 C D++EC C G +CVN G + C +PC G+ VN C Sbjct: 45 CEDINECTGDGKVCQPGTVCVNRVGGFTCQPMPCPSGYIRVNGVCEC 91 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYIC 381 +DEC +G A C G +C N G Y C Sbjct: 2 IDECREGLARCQLGTVCRNLAGGYRC 27 >SB_48275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 35.5 bits (78), Expect = 0.049 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 4/70 (5%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCF---DPDSLVKRCD-P 462 C+D++EC P C NT GS+ C C H +V + C P + K C Sbjct: 5 CLDINECRGNSGRGPCEHYCYNTDGSFYC-RCAEH-HVQSGYKCILQVCPPIISKSCPVD 62 Query: 463 SYCRRFNAVC 492 SY +F+ C Sbjct: 63 SYKDQFSEAC 72 >SB_47055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 933 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 295 CVDVDECADGRANCP--RGRLCVNTPGSYICVPCGGH 399 C+D+DEC C G+ C+NTPGS+ C G+ Sbjct: 488 CIDIDECQVNNGGCDIFHGQ-CINTPGSHHCACRNGY 523 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = +2 Query: 104 GCPSGYQ--WNGYTCVDMDECDL 166 GC G++ ++G TC+D+DEC + Sbjct: 474 GCYPGFKMAYDGRTCIDIDECQV 496 >SB_30640| Best HMM Match : EGF_CA (HMM E-Value=2.4e-09) Length = 42 Score = 35.5 bits (78), Expect = 0.049 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYIC 381 +DEC G+ CP + C NT GSY C Sbjct: 2 IDECQTGQITCPALKTCENTMGSYWC 27 >SB_12801| Best HMM Match : TSP_3 (HMM E-Value=2.3e-39) Length = 252 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/52 (34%), Positives = 21/52 (40%) Frame = +3 Query: 612 KKDNCPDVSNSGQEXXXXXXXXXXXXXXXXXXXIPNFPDNCPLTPNPDQLAT 767 + DNCP NS Q IP++ DNC L PN DQ T Sbjct: 140 RHDNCPGKPNSAQLDTDGDGRGDACDDDDDNDGIPDYRDNCRLVPNSDQRDT 191 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = +3 Query: 618 DNCPDVSNSGQEXXXXXXXXXXXXXXXXXXXIPNFPDNCPLTPNPDQLAT 767 DNCP +SN Q+ I N DNCPL N DQ T Sbjct: 45 DNCPTISNPDQKDTDGDGMGDLCDVDIDGDGIINVLDNCPLVSNRDQKNT 94 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 35.1 bits (77), Expect = 0.065 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +1 Query: 301 DVDECADGRANCPRGR-LCVNTPGSYIC 381 D+DEC+ G NC R C NT GS+ C Sbjct: 142 DIDECSSGSNNCHRDHAFCANTIGSFAC 169 >SB_32940| Best HMM Match : EGF (HMM E-Value=0) Length = 1025 Score = 35.1 bits (77), Expect = 0.065 Identities = 20/60 (33%), Positives = 28/60 (46%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRR 477 +D DECA + C G LC++ SY C G + +N D VK+C+ C R Sbjct: 122 IDEDECAS--SPCRNGGLCIDQVDSYKCSCKQGTFGLNCELLEEDVQKCVKQCEGGICWR 179 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 34.7 bits (76), Expect = 0.086 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 +DVDEC G C C N G Y C G++ Sbjct: 2904 LDVDECTSGTHQCMHNATCTNLEGGYRCTCVEGYF 2938 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +1 Query: 265 GTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 GTG R + +DV+EC C G C N GSY C Sbjct: 2815 GTGFTGARCN-IDVNECQSLEQPCFNGGTCSNLDGSYSC 2852 Score = 28.7 bits (61), Expect = 5.7 Identities = 26/89 (29%), Positives = 37/89 (41%), Gaps = 1/89 (1%) Frame = +1 Query: 328 ANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRRFNAVCGFGQK 507 ANC G CVN + C G T + C ++++ C PS C+ A C Sbjct: 1734 ANCSNGATCVNESNGFRCQCAVGF----TGKFC---EAIINPCAPSPCKN-GATC----- 1780 Query: 508 SFVIPVGLATAQCA-DWTEI*TDIRTSSC 591 G QCA D+T +IR ++C Sbjct: 1781 -IREAHGKYRCQCALDFTGFNCEIRVNNC 1808 >SB_8425| Best HMM Match : EGF (HMM E-Value=0) Length = 1955 Score = 34.7 bits (76), Expect = 0.086 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +1 Query: 262 RGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 R TGN+ + CVD++EC A+ P + C NT GS+ C Sbjct: 1190 RWTGNDPQ---CVDINEC--NSASSPCAQQCTNTEGSFTC 1224 >SB_56285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1127 Score = 34.3 bits (75), Expect = 0.11 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICV 384 D DEC+ G+ C C+N GSY C+ Sbjct: 314 DQDECSSGKHTCDEDAECINMRGSYTCM 341 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 34.3 bits (75), Expect = 0.11 Identities = 24/66 (36%), Positives = 27/66 (40%), Gaps = 2/66 (3%) Frame = +1 Query: 301 DVDECADGRANCPRG-RLCVNTPGSYICV-PCGGHYYVNTTRPCFDPDSLVKRCDPSYCR 474 D +EC++ C CVNTPGSY C P G Y R C D V C S Sbjct: 166 DYNECSEQSDECDHTLATCVNTPGSYACACPVG---YTANGRGCDD----VNECGVSDSC 218 Query: 475 RFNAVC 492 N C Sbjct: 219 HVNGTC 224 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 77 STSPYYECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSCRN 202 +T Y C CP GY NG C D++EC + C +C N Sbjct: 186 NTPGSYAC-ACPVGYTANGRGCDDVNECGVSDSCHVNGTCVN 226 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICV 384 C DV+EC + C CVNT GSY C+ Sbjct: 206 CDDVNECGVSDS-CHVNGTCVNTVGSYGCI 234 >SB_35208| Best HMM Match : EGF_CA (HMM E-Value=1.2e-09) Length = 598 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +1 Query: 298 VDVDECADGRANCP-RGRLCVNTPGSYICVPCGGHY 402 +DVDECA G C + CVNT Y C G+Y Sbjct: 450 IDVDECASGHHYCYWKSSTCVNTEPGYYCKCKPGYY 485 >SB_27178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 G E+R C D++ECA C CVNT GSY C Sbjct: 75 GFEKRDGVCKDINECAQPNHGCQ--DKCVNTVGSYRC 109 >SB_56885| Best HMM Match : EGF_CA (HMM E-Value=1.1e-08) Length = 77 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 98 CEGCPSGYQWNGYTCVDMDECDLIRPCD-DLVSCRN 202 C C GYQ C D+DEC+ PCD + +C N Sbjct: 17 CSKCSVGYQMKDNKCTDVDECE-SSPCDAESETCSN 51 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 271 GNERRREHCVDVDECADGRANCPRGRLCVNTPGSYIC 381 G + + C DVDEC + C N+PGSY C Sbjct: 23 GYQMKDNKCTDVDECESSPCDA-ESETCSNSPGSYSC 58 >SB_48962| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2225 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +2 Query: 23 TCVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDL-IRPCDDLVSC 196 TC ++C +P Y+C+ P GYQ CVD +C + CDD SC Sbjct: 1715 TCQDKNRGCGAIQKCATSPCAPGYKCKDFPEGYQCK---CVDATKCHMDTTGCDD-TSC 1769 >SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) Length = 1399 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 7/36 (19%) Frame = +1 Query: 295 CVDVDECADG-------RANCPRGRLCVNTPGSYIC 381 C DVDEC+DG + C + C NT GSY C Sbjct: 893 CKDVDECSDGVLREGKQESACHKDAACQNTVGSYAC 928 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 331 NCPRGRLCVNTPGSYICVPCGGH 399 +C + LC+NTPG+Y C G+ Sbjct: 805 DCHKHALCINTPGAYRCECADGY 827 >SB_29649| Best HMM Match : Sushi (HMM E-Value=4.1e-18) Length = 214 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTT-RPC 426 CVDV+ECA C CVNT S+ C+ C + +N+ R C Sbjct: 40 CVDVNECAKNNGGCQ--HTCVNTHRSFKCL-CNRGFSMNSNGRNC 81 >SB_18414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 389 QGTQMYEPGVLTQSRPLGQLARPSAHSSTS 300 QG Q YEP V T GQ A P AHSS S Sbjct: 79 QGAQRYEPSVFTHRAVGGQRACPVAHSSMS 108 >SB_16758| Best HMM Match : EGF_CA (HMM E-Value=5.5e-14) Length = 338 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYIC 381 +DEC+ G NC + C NT GS+ C Sbjct: 217 IDECSSGINNCHQDASCANTIGSFAC 242 >SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 V +DEC + A C C NTPGSY C G++ Sbjct: 465 VYIDECTNASA-CHVNAACTNTPGSYTCTCKQGYH 498 >SB_673| Best HMM Match : VWA (HMM E-Value=8.9e-25) Length = 257 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 277 ERRREHC-VDVDECADGRANCPRGRLCVNTPGSYICV-PCG 393 E+ ++C +V+EC D C G +C NT GSY+C P G Sbjct: 210 EKWGDNCNYNVNECLDNP--CKNGAVCKNTEGSYLCACPIG 248 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 265 GTGNERRREHCVDVDECADGRA-NCPRGRLCVNTPGSYICV 384 G+G V+EC D + NC G C++T GSY C+ Sbjct: 166 GSGQSISGVMITSVNECNDANSFNCSSGLECIDTYGSYACM 206 >SB_52794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1408 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/49 (42%), Positives = 24/49 (48%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 PGW G R H VD+DECA G C G C N G+Y C G+ Sbjct: 660 PGWTGD-----RCH-VDIDECALGF--CDNGATCNNFNGTYNCTCVPGY 700 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 334 CPRGRLCVNTPGSYIC 381 C G C NTPG+Y C Sbjct: 551 CKNGATCTNTPGNYSC 566 >SB_27269| Best HMM Match : EGF_CA (HMM E-Value=9.6e-10) Length = 43 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +1 Query: 304 VDECADGRANCPRGR-LCVNTPGSYIC 381 V+EC+ G NC R R C NT GS+ C Sbjct: 2 VNECSSGSINCHRDRATCANTIGSFAC 28 >SB_42336| Best HMM Match : Sushi (HMM E-Value=1.5e-08) Length = 303 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = +2 Query: 92 YECEGCPSGYQWNG-YTCVDMDEC-DLIRPCDDLVS-CRN 202 Y+C C G++ +G Y CVD+DEC + + CD + + C+N Sbjct: 28 YQCY-CKRGFKLSGQYHCVDIDECAEKLDKCDPVTTDCKN 66 Score = 30.7 bits (66), Expect = 1.4 Identities = 21/69 (30%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = +1 Query: 292 HCVDVDECADGRANC-PRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSY 468 HCVD+DECA+ C P C N Y C C + F S + +C + Sbjct: 43 HCVDIDECAEKLDKCDPVTTDCKNNVPLYQC-DC---------KKGFKTTSSIYKCQANV 92 Query: 469 CRRFNAVCG 495 C + V G Sbjct: 93 CSALSTVTG 101 >SB_42051| Best HMM Match : EGF_CA (HMM E-Value=6.9e-35) Length = 398 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 +DEC + + C G +C NT GSY C+ G Y N T C Sbjct: 303 LDEC-NSSSLCADGLVCHNTYGSYQCLCPVGKYGKNCTYTC 342 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 D DEC C G C NT GS+IC Sbjct: 39 DFDECTKP-GWCQNGGTCQNTNGSFIC 64 >SB_16935| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2204 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 C DV+EC+ C + C+NT GSY C+ G+ R C Sbjct: 71 CRDVNECSQSGHGCEQH--CMNTVGSYTCICELGYKLGQNGRSC 112 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFD 432 C DV+EC C + CVNT GS C G + C D Sbjct: 30 CDDVNECQSSLNPC--SQRCVNTRGSLYCACSSGFLLLGDGFTCRD 73 Score = 29.5 bits (63), Expect = 3.2 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = +1 Query: 289 EHC-VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPS 465 ++C DVD+C + +C G LCV+ +ICV VN C D D + R + S Sbjct: 1874 KYCETDVDDCE--KDSCLNGGLCVDKTNGFICVCKEPFIGVN----C-DTDDTICRQNAS 1926 Query: 466 YCRRFNAVC 492 C N C Sbjct: 1927 ICPH-NGTC 1934 >SB_31737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 32.3 bits (70), Expect = 0.46 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 298 VDVDECAD-GRANCPRGRLCVNTPGSYICV 384 VD+DECAD +C + +C N G + C+ Sbjct: 176 VDIDECADKSTHDCKKNEICENFAGGFECI 205 >SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) Length = 4833 Score = 32.3 bits (70), Expect = 0.46 Identities = 23/64 (35%), Positives = 28/64 (43%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRRF 480 D+DEC C C NTPG Y C C Y T + C D D + C S C + Sbjct: 3736 DIDECLTNP--CKHASACDNTPGGYTCT-CKPGY---TGQNC-DVD--INYCQSSPC-MY 3785 Query: 481 NAVC 492 N+ C Sbjct: 3786 NSTC 3789 >SB_17803| Best HMM Match : SRCR (HMM E-Value=0) Length = 1428 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 295 CVDVDECADG-RANCPRGRLCVNTPGSYICV 384 C DV+EC + R CP C+NT GS+ CV Sbjct: 384 CTDVNECNNSARVACPYE--CINTVGSFTCV 412 >SB_2661| Best HMM Match : EGF_CA (HMM E-Value=0.0062) Length = 87 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPC 390 VDEC + C G CVN PGS+ C C Sbjct: 27 VDECQEVD-KCSGGEYCVNEPGSFRCEAC 54 >SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 7645 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 289 EHC-VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCD 459 ++C +VD+CAD C G C++ Y CV G+Y N + S++ CD Sbjct: 7194 DNCETNVDDCADNP--CLNGATCIDGVNDYYCVCAIGYYSKNCEHISCNRFSVLLICD 7249 Score = 29.1 bits (62), Expect = 4.3 Identities = 22/72 (30%), Positives = 31/72 (43%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSYCRR 477 ++V+EC A C G CV+ SY C G+ VN +PD C P+ C + Sbjct: 6970 INVNECMS--APCKNGATCVDGINSYTCQCAVGYTGVNCET---NPDD----CHPNPC-Q 7019 Query: 478 FNAVCGFGQKSF 513 + C G F Sbjct: 7020 YGGTCVDGLDDF 7031 >SB_34004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = +2 Query: 11 GSASTCVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCV-DMDECDLIRPCDDL 187 G + CVT + P C+ Y C+ C SG+ G C D++EC +PC + Sbjct: 125 GDVNECVT-KKPCKNGASCINNEGG--YTCK-CTSGF--TGKNCENDVNECVTKKPCKNG 178 Query: 188 VSCRNEE 208 SC N + Sbjct: 179 ASCINNK 185 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHY 402 DV+EC + C G CVN+ G Y C CG + Sbjct: 204 DVNECMTTKP-CKNGGKCVNSDGGYRC-ECGDDF 235 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 DV+EC + C G C+N G Y C Sbjct: 126 DVNECVTKKP-CKNGASCINNEGGYTC 151 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 DV+EC + C G C+N G Y C Sbjct: 165 DVNECVTKKP-CKNGASCINNKGGYTC 190 Score = 27.9 bits (59), Expect = 9.9 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +2 Query: 26 CVTLRSPAARERRCMPKSTSPYYECEGCPSGYQWNGYTCV-DMDECDLIRPCDDLVSCRN 202 CVT + P C+ Y C+ C SG+ G C D++EC +PC + C N Sbjct: 169 CVT-KKPCKNGASCINNKGG--YTCK-CTSGF--TGKNCENDVNECMTTKPCKNGGKCVN 222 Query: 203 EE 208 + Sbjct: 223 SD 224 >SB_20112| Best HMM Match : EGF (HMM E-Value=0) Length = 2112 Score = 31.9 bits (69), Expect = 0.61 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 5/73 (6%) Frame = +1 Query: 298 VDVDECA--DGRANCPRGRLCVNTPGSYICV-PCGGHYYV-NTTRPC-FDPDSLVKRCDP 462 V++DEC D C G CV+ GSY C+ P G + N C +P S C Sbjct: 179 VNIDECKQNDPFPRCQHGGTCVDKIGSYTCICPPGKTGLICNFDDECASNPCSENATCVT 238 Query: 463 SYCRRFNAVCGFG 501 S+ + + +C G Sbjct: 239 SFSGKASCICNSG 251 Score = 31.5 bits (68), Expect = 0.80 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYIC 381 +DVDEC C G C N G Y+C Sbjct: 139 IDVDECTTLSQPCQNGGTCSNVYGGYMC 166 Score = 31.5 bits (68), Expect = 0.80 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYIC 381 VD+ EC + C G C + PGS++C Sbjct: 259 VDIKECEGDSSPCYHGGTCRDIPGSFVC 286 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYIC 381 VDVDECA + C+N G+Y C Sbjct: 910 VDVDECASSPCSALGTEKCINNIGAYHC 937 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 31.9 bits (69), Expect = 0.61 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYIC 381 ++EC G +C LC+N P S+IC Sbjct: 2 INECEIGSHDCHSDALCINYPSSFIC 27 >SB_54839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1409 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGH 399 DVDECA G C G +C N+ G Y C G+ Sbjct: 1230 DVDECA-GVNPCHHGGVCSNSHGGYSCKCASGY 1261 >SB_58558| Best HMM Match : EGF (HMM E-Value=0) Length = 1101 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLV 447 DVDECA C G C N +Y C G+ +N T D + +V Sbjct: 236 DVDECAP--QPCKNGATCNNLFNNYTCTCAAGYTGINCTENIDDCNGVV 282 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 107 CPSGYQWNGYTCV-DMDECDLIRPCDDLVSCRN 202 CP G W G C D+DEC +PC + +C N Sbjct: 224 CPKG--WTGKNCTEDVDEC-APQPCKNGATCNN 253 >SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1112 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCD-PSYC 471 D+DEC +C + LC NT S+ C G+ ++ + C D + C+ P C Sbjct: 624 DIDECKSFNGHCLQ--LCTNTKTSFYCSCFSGYELMDDRKSCRD----INECEIPGMC 675 >SB_12832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1169 Score = 31.5 bits (68), Expect = 0.80 Identities = 27/87 (31%), Positives = 34/87 (39%), Gaps = 4/87 (4%) Frame = +1 Query: 310 ECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSLVKRCDPSY-CRRFNA 486 EC D CP G C NT PC YY NT R + RC+ + C +A Sbjct: 193 ECLD----CPLGHECPNTHSRP--TPCSSGYYANTLR-----KTACVRCEAGFKCPTTSA 241 Query: 487 ---VCGFGQKSFVIPVGLATAQCADWT 558 C G+K P G+ C + T Sbjct: 242 APIACSSGKKC-PFPEGVGIQDCGEGT 267 >SB_8569| Best HMM Match : EGF_CA (HMM E-Value=7.4e-06) Length = 63 Score = 31.5 bits (68), Expect = 0.80 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPC--GGHYYVNTTRPCFDPDSLVK 450 V+EC G C + CVNTPGSY C C G + + C D D ++ Sbjct: 2 VNECMMGGVKCDQK--CVNTPGSYRC-ECYRGFRQSDDVLKKCIDIDECLE 49 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPG 369 C+D+DEC +G +C + C NT G Sbjct: 41 CIDIDECLEGLPDCHK---CTNTAG 62 >SB_20014| Best HMM Match : EGF_CA (HMM E-Value=1.6e-18) Length = 184 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 C D+DEC G C C NT GSY C G + + C Sbjct: 55 CEDIDECDTGLHKCE--HQCNNTFGSYSCSCSPGFALADDKKSC 96 >SB_52861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1487 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICV 384 C +EC +GR NC + CV+TP + CV Sbjct: 190 CPLENECLNGRHNCSALQNCVDTPEFFRCV 219 >SB_46694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYIC 381 +DECA G C C NT G Y C Sbjct: 2 IDECASGTHKCNAKSTCNNTKGGYNC 27 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 31.1 bits (67), Expect = 1.1 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 4/66 (6%) Frame = -2 Query: 351 KPSPWTVGSSVSALVHIHAMFPSSLIASA----PPARLPVNPGGHGPQVKPPSSLRHETR 184 +P+P+ VGS L H + F SS IAS+ P R ++ G QV ++L+ E R Sbjct: 59 QPTPF-VGSDERRLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQVGLLTNLKFENR 117 Query: 183 SSQGRI 166 S+ G + Sbjct: 118 SATGAL 123 >SB_57511| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 879 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 DV+ECA C G C NT GSY C Sbjct: 572 DVNECATDP--CDNGGTCANTDGSYTC 596 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 DV+ECA C G C NT GSY C Sbjct: 686 DVNECATDP--CDNGGTCANTDGSYTC 710 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 DV+ECA C G C NT G Y C Sbjct: 495 DVNECA-ASPPCVNGGSCTNTAGDYHC 520 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 307 DECADGRANCPRGRLCVNTPGSYICV 384 DECA C G CVNT GSY C+ Sbjct: 459 DECA--LKPCAYGGSCVNTMGSYQCL 482 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +1 Query: 301 DVDECADGRAN-CPRGRLCVNTPGSYICVPCGGHYYVN 411 DVDEC AN C C N GSY C G +N Sbjct: 648 DVDECV---ANPCANQGTCYNNDGSYTCACVAGRTGLN 682 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 DV+ECA C C NT GSY C Sbjct: 800 DVNECATDP--CDNRGTCANTDGSYTC 824 >SB_45116| Best HMM Match : EGF (HMM E-Value=0) Length = 2023 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 289 EHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 EHC ++ EC A C G CV+ Y C G+ +N Sbjct: 158 EHCEEIKECTS--APCQNGGSCVDRRDGYTCTCEAGYNGIN 196 >SB_40116| Best HMM Match : EGF (HMM E-Value=0) Length = 340 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +1 Query: 289 EHC-VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 ++C +VD+CAD C G C++ Y CV G+Y N Sbjct: 148 DNCETNVDDCADNP--CLNGATCIDGVNDYYCVCAIGYYSKN 187 >SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1021 Score = 30.7 bits (66), Expect = 1.4 Identities = 23/83 (27%), Positives = 36/83 (43%) Frame = -2 Query: 348 PSPWTVGSSVSALVHIHAMFPSSLIASAPPARLPVNPGGHGPQVKPPSSLRHETRSSQGR 169 PSP + GS + L FP++ + P + P +P H P+ S+Q R Sbjct: 790 PSPTSTGSPQTPLTPHTPRFPNTAPSPGEPNKPPFSPSNHQAAFPTPAGF-----STQKR 844 Query: 168 IKSHSSISTHVYPFHW*PLGHPS 100 + + SS T +P + LG S Sbjct: 845 LNNDSS-DTETHPQGFMDLGSKS 866 >SB_23022| Best HMM Match : CUB (HMM E-Value=0) Length = 1307 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 D DEC + + C +CVNT GSY C Sbjct: 130 DEDECRERKGGCQH--ICVNTIGSYRC 154 >SB_21597| Best HMM Match : ig (HMM E-Value=2.9e-14) Length = 1931 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 304 VDECA-DGRANCPRGRLCVNTPGSYICVPCGGHYYVNT 414 +DEC+ G C + CVN GSY C+ C YY+ T Sbjct: 2 IDECSLPGPGGCSQS--CVNVIGSYYCM-CRHGYYLGT 36 >SB_7343| Best HMM Match : EGF (HMM E-Value=0) Length = 1233 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 35 LRSPAARERRCMPKSTSPY-YECEGCPSGYQWNGYTCVDMDECDLIRPCD 181 + +P C P P+ Y+C+ CPSGYQ G +C + C + PC+ Sbjct: 689 VNNPCHNGGTCTPDGDDPHDYDCK-CPSGYQ--GKSCTLISAC-VGDPCN 734 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 2/81 (2%) Frame = +1 Query: 253 PGWRGTGNERRREHCVDVDECADGRANC--PRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 PGWRG R C+D + CA G + C +G + + P + C +N P Sbjct: 994 PGWRGLYCGSRSIPCLDYNPCAFG-STCREKQGVVTCDCPLGRTGLTCS--QKLNIQVPL 1050 Query: 427 FDPDSLVKRCDPSYCRRFNAV 489 F S ++ P+Y R ++ Sbjct: 1051 FKESSYMEFKSPAYIRTVTSI 1071 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +2 Query: 59 RRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSCR 199 +R + SP Y C C GY G C + + C+ + PC + +C+ Sbjct: 352 KRTVGSDGSPGYNCT-CAPGYL--GTNCTERNLCEPVNPCANGGTCK 395 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 +DVDEC+ + C G C+ G Y C H N + DP Sbjct: 39 LDVDECSS--SPCQNGASCIKKVGRYFCECSTAHVGKNCHKNFTDP 82 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 DVDEC+ + C G C+ G Y C H N + DP Sbjct: 301 DVDECSS--SPCQNGASCIKKVGRYFCECSTAHVGKNCHKNFTDP 343 >SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) Length = 1264 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 121 VAAGTSFTLVIRAGAFGHTASLSSRRASERHTRA 20 + AG ++RA AF H+ASLSS R +++ T A Sbjct: 884 LTAGALVLAMVRAFAFCHSASLSSNRLNDKMTVA 917 >SB_10743| Best HMM Match : ABC_membrane (HMM E-Value=0.23) Length = 282 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 121 VAAGTSFTLVIRAGAFGHTASLSSRRASERHTRA 20 + AG ++RA AF H+ASLSS R +++ T A Sbjct: 124 LTAGALVLAMVRAFAFCHSASLSSNRLNDKMTVA 157 >SB_52147| Best HMM Match : EGF (HMM E-Value=0) Length = 364 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 41 SPAARERRCMPKSTSPYYECEGCPSGYQWNGYTC-VDMDECDLIRPCDDLVSCRN 202 +P C+P+ S YY C C G+ G C D+DEC PC V C N Sbjct: 288 NPCGNHGMCVPRD-STYY-C-ACDVGF--TGDRCEADIDECGASTPCFPGVLCSN 337 >SB_51220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 292 HCVDVDECADGRANCPRGRLCVNTPGSYICV 384 +C DV+EC+ C G+ C+N G Y CV Sbjct: 1388 NCTDVNECSSPDI-CQSGQKCLNFFGGYQCV 1417 >SB_50933| Best HMM Match : Laminin_EGF (HMM E-Value=0.0069) Length = 233 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYIC 381 VDEC + C G CVN PGS+ C Sbjct: 127 VDECQEVD-KCSGGEYCVNEPGSFRC 151 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPC-GGHY 402 VD+C CP GR CVN G+ VPC GHY Sbjct: 2872 VDDCTP----CPAGRYCVN--GTAFGVPCPPGHY 2899 >SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) Length = 318 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 DVDEC+ + C G C+ G Y C H N + DP Sbjct: 97 DVDECSS--SPCQNGASCIKKVGRYFCECSTAHVGKNCHKNFTDP 139 >SB_3454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 504 KVVCNTGWTGNGTVCGLDRDLDGHPDEQ 587 K VCN G+ G+G C D+ GH DE+ Sbjct: 97 KCVCNPGYIGDGITC----DVTGHEDEK 120 >SB_57514| Best HMM Match : EGF_CA (HMM E-Value=2.4e-20) Length = 337 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYIC 381 D+DEC C G +C NT G Y C Sbjct: 181 DLDECKTN-GPCANGGICTNTDGGYNC 206 >SB_21404| Best HMM Match : VWA (HMM E-Value=8.1e-27) Length = 267 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +1 Query: 301 DVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDP 435 DVDEC+ + C G C+ G Y C H N + DP Sbjct: 41 DVDECSS--SPCQNGASCIKKVGRYFCECSTAHVGKNCHKNFTDP 83 >SB_4238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1288 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 C DVDECA +C ++C N+ GSY C G+ + C Sbjct: 866 CRDVDECAIP-GSC--SQMCFNSKGSYKCTCMEGYRLEPDKKTC 906 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPCFDPDSL 444 C D++EC + ++C + C NT GS+ C G+ R C DS+ Sbjct: 1203 CEDINECLNS-SSC--SQRCFNTRGSFSCKCVQGYRLEPDKRRCKAADSI 1249 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/56 (35%), Positives = 25/56 (44%) Frame = +1 Query: 259 WRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 W G + C DV+EC R C+NT GS+ CV G YV T+ C Sbjct: 3394 WPGFELKPFTNKCEDVNECLHFGVCSQR---CINTRGSFKCVCHEG--YVLTSGSC 3444 >SB_38040| Best HMM Match : F5_F8_type_C (HMM E-Value=8.4e-30) Length = 351 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C DV+EC D C C NT GSY C Sbjct: 153 CEDVNEC-DTSNPCHVNATCTNTVGSYEC 180 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 134 YTCVDMDECDLIRPCDDLVSCRN 202 Y C D++ECD PC +C N Sbjct: 151 YKCEDVNECDTSNPCHVNATCTN 173 >SB_16910| Best HMM Match : EGF (HMM E-Value=0) Length = 1552 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICV 384 +D+DECA + C G C++ G Y CV Sbjct: 1139 IDIDECAS--SPCQAGAHCLDLIGDYTCV 1165 >SB_34550| Best HMM Match : VWA (HMM E-Value=0) Length = 519 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICV 384 +DVDEC + C + + C+N+ GS+ CV Sbjct: 38 LDVDECKS--SPCNKNQNCINSFGSFTCV 64 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 35 LRSPAARE-RRCMPKSTSPYYECEGCPSGYQWNGYTCVDMDECDLIRP 175 L PA E +C + + C+ C +GY NGY C + +ECD P Sbjct: 499 LSGPAVDECEKCDINAICVHGRCK-CRAGYIGNGYEC-EKEECDGCNP 544 >SB_14708| Best HMM Match : IF-2B (HMM E-Value=0) Length = 350 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +3 Query: 75 KAPALITSVKDVPAATSGMGTRAWIWTNAI*FGPVMIWSRVVTK 206 ++P +TSVK +P A SG+G +W A P + + +VT+ Sbjct: 293 RSPLELTSVKGIPVAASGIG----VWNPAFDVTPAGLITGIVTE 332 >SB_12383| Best HMM Match : EGF_CA (HMM E-Value=2.5e-12) Length = 228 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYIC 381 C DV+EC D C C NT GSY C Sbjct: 130 CEDVNEC-DTSNPCHVNATCTNTVGSYEC 157 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 134 YTCVDMDECDLIRPCDDLVSCRN 202 Y C D++ECD PC +C N Sbjct: 128 YKCEDVNECDTSNPCHVNATCTN 150 >SB_1891| Best HMM Match : EGF (HMM E-Value=6.5e-15) Length = 106 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICV 384 +DVDEC + C + + C+N+ GS+ CV Sbjct: 67 LDVDECKS--SPCNKNQNCINSFGSFTCV 93 >SB_58789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +1 Query: 289 EHCVDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTR 420 E V EC C +G + + GSY CV C +Y N R Sbjct: 489 EKIVGQSECCWNCQRCEKGTVS-SEAGSYACVVCNETHYDNAAR 531 >SB_30534| Best HMM Match : EGF (HMM E-Value=0.12) Length = 521 Score = 29.1 bits (62), Expect = 4.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDE 157 + C CP G+ NG C D++E Sbjct: 498 FRCGPCPPGFSGNGIRCTDVNE 519 >SB_12758| Best HMM Match : EGF (HMM E-Value=2.5e-15) Length = 165 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = +2 Query: 17 ASTCVTLRSPAARERRCMPKSTSPY-YECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVS 193 A TC SP + C S Y C CP+G+ +G C + CD PC ++ Sbjct: 24 ADTCTP--SPCHADVTCYQDPVSDVGYRCGPCPAGFTGDGRACTRI--CD--HPCPYGMT 77 Query: 194 C 196 C Sbjct: 78 C 78 >SB_58268| Best HMM Match : Extensin_2 (HMM E-Value=0.002) Length = 458 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = +2 Query: 53 RERRCMPKSTSPYYECEGCPSGYQWNGY---TCVDMDECDLIRP--CDDLVSCRN 202 R+RRC P + YY CP + Y C + +C R C L C N Sbjct: 102 RKRRCPPLNKCTYYRKRRCPPLTRCTNYRKRRCPPLTKCTNYRKRRCPPLTKCTN 156 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/53 (32%), Positives = 21/53 (39%), Gaps = 5/53 (9%) Frame = +2 Query: 53 RERRCMPKSTSPYYECEGCPSGYQWNGY---TCVDMDECD--LIRPCDDLVSC 196 R+RRC P + YY CP + Y C + C L R C L C Sbjct: 214 RKRRCPPLTKCTYYRKRRCPPLTKCTNYRKRRCPPLTRCTNYLKRRCPPLTRC 266 >SB_42694| Best HMM Match : EGF_CA (HMM E-Value=1.2e-08) Length = 142 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVNTTRPC 426 VDEC D +G +C+NT GS+ C G+ + + C Sbjct: 2 VDECIDDPC---QGGICINTIGSFNCSCIKGYEFDTGLKQC 39 >SB_44694| Best HMM Match : EGF_CA (HMM E-Value=0.00091) Length = 44 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYIC 381 +DEC+ C G C NTPG++ C Sbjct: 2 IDECSISAGLCGNGT-CTNTPGAFRC 26 >SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 1131 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/63 (31%), Positives = 27/63 (42%) Frame = +3 Query: 456 RPQLLQTIQRRLWFRTKVVCNTGWTGNGTVCGLDRDLDGHPDEQLPCNEPRCKKDNCPDV 635 R LL+T++ R TK + T T G D P +P P +D+CPDV Sbjct: 13 RRHLLKTVEGRGEPDTKEPRDQEKTNTPTTGGTTPTTDASP-AHIPDEAPSAIEDDCPDV 71 Query: 636 SNS 644 S Sbjct: 72 KRS 74 >SB_25563| Best HMM Match : HEAT (HMM E-Value=2.5e-20) Length = 1803 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 8/45 (17%) Frame = +2 Query: 71 PKSTSPYYECEG--------CPSGYQWNGYTCVDMDECDLIRPCD 181 PK S YY C+G CP+G WN + D DL+ CD Sbjct: 1502 PKDCSKYYHCDGYDDGRLRSCPTGQLWN-HVNKKCDRADLV-ICD 1544 >SB_27599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2937 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICVPCGGHYYVN 411 ++VD+CA C G CV+ SY+C G+ +N Sbjct: 132 INVDDCAS--EPCLNGGACVDGANSYLCSCTAGYTGIN 167 >SB_9722| Best HMM Match : EGF_CA (HMM E-Value=2.4e-06) Length = 673 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 304 VDECADGRANCPRGRLCVNTPGSYIC 381 ++EC +NC C NT GS+ C Sbjct: 546 INECLVEMSNCHGNATCANTAGSFTC 571 >SB_2045| Best HMM Match : EGF (HMM E-Value=0) Length = 1101 Score = 28.7 bits (61), Expect = 5.7 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYIC 381 +D+DEC C++ PG+Y C Sbjct: 987 IDIDECVSSPCGNVSNTKCIDLPGNYSC 1014 >SB_42355| Best HMM Match : EGF (HMM E-Value=2.9e-05) Length = 241 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 Query: 101 EGCPSGYQWNGYTCVDMDECDLIRPCDDLVSC 196 E C S +W+ Y DEC PC + SC Sbjct: 141 ENCVSDAKWHQYVVPTKDECFTGNPCKNGGSC 172 >SB_32719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 98 CEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSCR 199 CE C SG+ NG+ C ++ + PC++ CR Sbjct: 397 CE-CRSGFVGNGFKCTATEDPCIPNPCENGGICR 429 >SB_30861| Best HMM Match : Peptidase_A17 (HMM E-Value=2.1e-40) Length = 1740 Score = 28.3 bits (60), Expect = 7.5 Identities = 20/66 (30%), Positives = 23/66 (34%) Frame = -2 Query: 582 RPDVRLDLCPVRTLCRCQSNRYYKRLLSETTDGVESSAVAGVASLHQRVGVEARPRRVHV 403 RP D C T C C+S R + LL E + S E PRR H Sbjct: 477 RPGHMRDRCHTTTFCNCKSERKHHTLL-HNPPRAEDDPPKELNSSAGEGTTEGPPRRDHA 535 Query: 402 VVTAAG 385 T G Sbjct: 536 QGTRGG 541 >SB_22289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1102 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 92 YECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSCRNEE 208 + C CP+GYQ +GY+ + EC C++ SC N + Sbjct: 407 FYCTKCPNGYQ-HGYSGFGIFECS---ECNNDSSCFNSQ 441 >SB_8486| Best HMM Match : Granulin (HMM E-Value=0) Length = 878 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +1 Query: 313 CADGRANCPRGRLCVN-TPGSYICVP 387 C DG + CP G C + G Y C P Sbjct: 272 CPDGASECPDGNTCCKLSSGQYGCCP 297 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +1 Query: 313 CADGRANCPRGRLCVN-TPGSYICVP 387 C DG + CP G C + G Y C P Sbjct: 347 CPDGTSQCPDGNTCCKLSSGQYGCCP 372 >SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10) Length = 968 Score = 27.9 bits (59), Expect = 9.9 Identities = 38/135 (28%), Positives = 49/135 (36%), Gaps = 3/135 (2%) Frame = -2 Query: 624 SCPSCSEAHYKAAARPDVRLDLCPVRTLCRCQSNRYYKRLLSETTDGVESSAVAGVASLH 445 S P+ + A Y A P + CPV + RL +E T S +H Sbjct: 655 STPTPTHAEYTHAYTPSTQTPTCPV-----------HPRLHTEYTHAYTPSTPTPTRPVH 703 Query: 444 QRVGVE---ARPRRVHVVVTAAGYADV*TRGIDAKPSPWTVGSSVSALVHIHAMFPSSLI 274 R+ E A RRVH + A Y T PS T V H+HA + + Sbjct: 704 PRLHTEYIHAYTRRVHPRLHAQ-YTHAYT------PSTHTPTRPVHP--HLHAQYTHAYT 754 Query: 273 ASAPPARLPVNPGGH 229 S PVNP H Sbjct: 755 PSTHTLTRPVNPRLH 769 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 65 CMPKSTSPYYECEGCPSGYQWNGYTCVDMDEC 160 C STS +C C G Y CV D+C Sbjct: 479 CTTCSTSDPKKCTFCAKGRFLQNYACVTADQC 510 >SB_39510| Best HMM Match : VWA (HMM E-Value=0) Length = 705 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 298 VDVDECADGRANCPRGRLCVNTPGSYICV 384 +DVD+C + C + + C+N+ GS+ CV Sbjct: 38 LDVDKCKS--SPCNKNQNCINSFGSFTCV 64 >SB_35462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 125 WNGYTCVDMDECDLIRPCDDLVSCRN 202 W GYT +D+D+ + D++ C N Sbjct: 159 WKGYTVLDIDDWSSAKESYDVIGCLN 184 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +1 Query: 10 RQCQHVCDAQKPCG*RATLYAQKHQPLLRV*RMSQRL---PVEW 132 RQ QH+ + PCG +K++P+++V S + VEW Sbjct: 179 RQVQHILASTSPCGRCVVWDLRKNEPIIKVSDQSATIRCKAVEW 222 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 448 KRCDPSYC-RRFNAVCGFGQKSFVIPVGLATAQCA 549 K C P C ++ VCG K++ LATA+CA Sbjct: 233 KSCPPRTCPKQDKPVCGSDGKTYTNGCELATAKCA 267 >SB_30275| Best HMM Match : EGF_CA (HMM E-Value=1.3e-13) Length = 142 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 134 YTCVDMDECDLIRPCDDLVSCRN 202 Y C D++EC+ PC +C N Sbjct: 96 YKCEDLNECETSNPCHVNATCTN 118 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 295 CVDVDECADGRANCPRGRLCVNTPGSYICV 384 C D++EC C C NT GSY C+ Sbjct: 98 CEDLNECETSNP-CHVNATCTNTMGSYECL 126 >SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1434 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +2 Query: 35 LRSPAARERRCMPKSTSPYYECEGCPSGY-QWNGY 136 L S A + C P +P Y G P GY Q GY Sbjct: 265 LPSSCAPQNPCSPPGCTPQYSTYGYPQGYPQATGY 299 >SB_40674| Best HMM Match : Extensin_2 (HMM E-Value=0.19) Length = 291 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +2 Query: 53 RERRCMPKSTSPYYECEGCPSGYQWNGY---TCVDMDECD--LIRPCDDLVSCRN 202 R+RRC P + Y CP + N Y C + +C L R C L C N Sbjct: 178 RKRRCPPLTRCTNYRKRRCPPLTKCNYYRKRRCPRLTKCTYYLKRRCPPLTKCTN 232 >SB_40416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 263 GALAMRDEGNIAWMWTSALT 322 G L RD +IAW W++A T Sbjct: 50 GVLLHRDNSDIAWSWSNAFT 69 >SB_32040| Best HMM Match : zf-CCHC (HMM E-Value=0.01) Length = 471 Score = 27.9 bits (59), Expect = 9.9 Identities = 19/66 (28%), Positives = 25/66 (37%) Frame = -2 Query: 582 RPDVRLDLCPVRTLCRCQSNRYYKRLLSETTDGVESSAVAGVASLHQRVGVEARPRRVHV 403 RP D C T C C+S R + LL + +S + + E PRR H Sbjct: 313 RPGHMRDRCHTTTFCNCKSERKHHTLLHNPPRAKDDPPKELNSSAGEGM-TEGPPRRDHA 371 Query: 402 VVTAAG 385 T G Sbjct: 372 QGTRGG 377 >SB_5393| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1244 Score = 27.9 bits (59), Expect = 9.9 Identities = 19/66 (28%), Positives = 25/66 (37%) Frame = -2 Query: 582 RPDVRLDLCPVRTLCRCQSNRYYKRLLSETTDGVESSAVAGVASLHQRVGVEARPRRVHV 403 RP D C T C C+S R + LL + +S + + E PRR H Sbjct: 271 RPGHMRDRCHTTTFCNCKSERKHHTLLHNPPRAKDDPPKELNSSAGEGM-TEGPPRRDHA 329 Query: 402 VVTAAG 385 T G Sbjct: 330 QGTRGG 335 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,406,871 Number of Sequences: 59808 Number of extensions: 595755 Number of successful extensions: 3365 Number of sequences better than 10.0: 194 Number of HSP's better than 10.0 without gapping: 2022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3261 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -