BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30389 (790 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 27 0.15 M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 27 0.20 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 26 0.46 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 4.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 4.3 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 7.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 9.9 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 27.5 bits (58), Expect = 0.15 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 194 TRPDHHRAESNRIRPYPRTCTHSTGS 117 T P H + +S ++RPYP H+ G+ Sbjct: 216 TVPKHSKTKSPKLRPYPNWEWHTVGN 241 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 27.1 bits (57), Expect = 0.20 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 165 KSHSSISTHVYPFHW*PLGHP 103 K H S ++ P+H P GHP Sbjct: 65 KEHKMASMNIVPYHMSPYGHP 85 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.8 bits (54), Expect = 0.46 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +1 Query: 256 GWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPGSYICVP 387 G +GT +R + D D + RG + V+ GSY VP Sbjct: 1029 GGKGTRPKRGKYRNYDRDSLVEAVRAVQRGEMSVHRAGSYYGVP 1072 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 4.3 Identities = 11/52 (21%), Positives = 18/52 (34%) Frame = -1 Query: 331 WLVRQRTRPHPRNVPFVSHCQCPASPATCEPWRTRPTGEAAFFVTTRDQIIT 176 W+V RN HCQ P W+ ++ + R++ T Sbjct: 712 WIVEPTDVSVERNKHVALHCQAQGVPTPTIVWKKATGSKSGEYEELRERAYT 763 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 4.3 Identities = 11/52 (21%), Positives = 18/52 (34%) Frame = -1 Query: 331 WLVRQRTRPHPRNVPFVSHCQCPASPATCEPWRTRPTGEAAFFVTTRDQIIT 176 W+V RN HCQ P W+ ++ + R++ T Sbjct: 708 WIVEPTDVSVERNKHVALHCQAQGVPTPTIVWKKATGSKSGEYEELRERAYT 759 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 7.5 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = +2 Query: 140 CVDMDECDLIRPCDDLVSCRNE 205 C D D CD C C N+ Sbjct: 749 CCDFDACDCEMTCPAGCKCYND 770 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 732 CPLTPNPDQL 761 CPL PNP L Sbjct: 219 CPLNPNPQPL 228 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,171 Number of Sequences: 438 Number of extensions: 4877 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24882285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -