BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30387 (778 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0286 + 13915705-13915984,13916478-13917062,13918188-139186... 31 1.0 02_05_0226 + 26971851-26972034,26972734-26972834,26972876-269729... 29 4.1 12_02_0957 + 24807261-24807311,24807436-24807773,24808727-248089... 28 7.2 01_01_0678 - 5209468-5209534,5209588-5209755,5212135-5212292 28 7.2 03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838,235... 28 9.5 >04_03_0286 + 13915705-13915984,13916478-13917062,13918188-13918661, 13918963-13920208,13920282-13920297 Length = 866 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -3 Query: 563 KCIFRNGKTEIIDT*SKNFLIVFFLHVYS 477 + +F+NG TEIID+ S +L V F H S Sbjct: 77 RLLFKNGTTEIIDSPSTEYLDVMFSHSIS 105 >02_05_0226 + 26971851-26972034,26972734-26972834,26972876-26972978, 26973335-26973477,26973525-26973605,26973929-26974015, 26974097-26974239,26974746-26974896,26974973-26975095, 26975362-26975445,26975531-26975718,26976726-26976900, 26977008-26977129,26977231-26977310,26977532-26977590, 26977921-26978075,26978680-26978858,26980050-26980162, 26980243-26980413,26980552-26980680,26980756-26980856, 26980942-26981059,26981739-26981818,26983230-26983302, 26983865-26983950,26984025-26984076,26984221-26984352, 26984560-26984628,26984912-26985004,26985806-26985901, 26986710-26986808,26986894-26986986,26987459-26987608, 26988391-26988549 Length = 1323 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 63 LADFWRQGICMHRRLCVVYVLIFCGFYI 146 +A FW GI H CV + ++F G + Sbjct: 795 IAQFWSSGIASHEPTCVDFEIVFHGISV 822 >12_02_0957 + 24807261-24807311,24807436-24807773,24808727-24808927, 24809024-24809069,24809284-24809600,24809949-24810072, 24810465-24810537,24810968-24811173,24811384-24811651, 24811780-24811877,24812116-24812379 Length = 661 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = -2 Query: 177 ITLYFICTFNIYKNHKKLT---HTRRRGVCA 94 + ++ IC F + KN KKLT H R+G C+ Sbjct: 631 LEIHDICLFQLMKNKKKLTMTVHIIRKGECS 661 >01_01_0678 - 5209468-5209534,5209588-5209755,5212135-5212292 Length = 130 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 739 HP-TCTFYVLRRGISHSAYGKNETS 668 HP +C F +GISHS+ KN TS Sbjct: 84 HPFSCVFSTDEKGISHSSRAKNPTS 108 >03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838, 2353031-2353708,2353800-2353964,2354139-2354433, 2354581-2354795,2354885-2355190,2355269-2355332, 2355426-2355665,2355783-2355886 Length = 1505 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -3 Query: 734 NMYILRLTSWHLTFRLR*ERDESQNVPCRHIEIDNYKSLSV 612 NM IL+L +W +RL+ E E +NV C+ + Y +V Sbjct: 494 NMRILKLQAWEDRYRLKLE--EMRNVECKWLRWALYSQAAV 532 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,883,776 Number of Sequences: 37544 Number of extensions: 381922 Number of successful extensions: 742 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2080154268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -