BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30381 (369 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 34 0.002 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 31 0.018 DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 26 0.52 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 26 0.52 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 25 0.90 AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. 24 1.6 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 24 1.6 AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 24 2.1 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 3.6 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 3.6 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 4.8 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 4.8 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 22 6.4 AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive ... 22 6.4 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 22 6.4 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 33.9 bits (74), Expect = 0.002 Identities = 32/109 (29%), Positives = 46/109 (42%), Gaps = 14/109 (12%) Frame = +1 Query: 34 LLFIISCLGINSAECP---PDQYDP-GPNCAFETI-------CA-LRSAHSNRKHYC--D 171 L+ +I L CP P YD GPN F+T CA L C Sbjct: 10 LIVLIFTLQNAHCACPYAHPYPYDVCGPNEEFQTCGTACPNTCADLNELQKPCTKQCIQG 69 Query: 172 CWCKPGLIRDSIAHKCVKECPKYDEILDSYIIPISLLFGRIDDVIFYVK 318 C+CKPG +R+S KC+ +C + L ++LF R+ Y++ Sbjct: 70 CFCKPGFVRESKEGKCIPKCSNENMPLSK--TSTAILFVRLVTPCLYLR 116 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 30.7 bits (66), Expect = 0.018 Identities = 12/54 (22%), Positives = 24/54 (44%) Frame = +1 Query: 61 INSAECPPDQYDPGPNCAFETICALRSAHSNRKHYCDCWCKPGLIRDSIAHKCV 222 + + ECPPD+ ++ C + Y +C+C G +R+ +C+ Sbjct: 50 VPTKECPPDEVFKCCGPCYQLNCYGTVLDCAGRCYAECYCASGFVREYPGGRCI 103 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 25.8 bits (54), Expect = 0.52 Identities = 9/24 (37%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +1 Query: 172 CWCKPGLIRDSIAHKCV--KECPK 237 C+CK +R +I C+ K+CP+ Sbjct: 72 CFCKKNYVRRAIGGSCIWAKKCPR 95 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 25.8 bits (54), Expect = 0.52 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 169 DCWCKPGLIRDSIAHKCVKECPKY 240 DC+CKPG+ + KC K P Y Sbjct: 957 DCFCKPGV----VGKKCDKCAPAY 976 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 25.0 bits (52), Expect = 0.90 Identities = 10/23 (43%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +1 Query: 172 CWCKPGLIRDSIAHKCV--KECP 234 C+CKP IR S C+ CP Sbjct: 172 CFCKPSYIRSSDGGPCIPTNNCP 194 >AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. Length = 167 Score = 24.2 bits (50), Expect = 1.6 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +1 Query: 82 PDQYDPGPNCAFETICALRSAHS-NRKHYCDC 174 PD + NCA E CA R+ RK DC Sbjct: 86 PDSQNAYANCANEPYCAARTVQGYMRKFGQDC 117 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 24.2 bits (50), Expect = 1.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -3 Query: 343 KLIKHLFKISHRKLHHLYARTVMRSELCNYPEFHRI 236 +L++HL + L H RT+ R+ PE R+ Sbjct: 224 RLLRHLPNLRLLTLWHNKLRTLSRAAFAGVPELERL 259 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 23.8 bits (49), Expect = 2.1 Identities = 17/71 (23%), Positives = 29/71 (40%) Frame = -3 Query: 316 SHRKLHHLYARTVMRSELCNYPEFHRISGILSHICER*SPL*GQACTXXXXXXXXXSVRF 137 SH++ H L +E CNY F IL + S + + CT + + Sbjct: 133 SHKRTHRLSDSDGGSTEGCNYDLFAEQCDILQEMFPDSSFIEVKHCTLIANGDVDRATQI 192 Query: 136 VMHRLSRRRNL 104 ++HR ++L Sbjct: 193 LLHRQEAGQSL 203 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/24 (37%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +1 Query: 172 CWCKPGLIRDSIAHKCV--KECPK 237 C CK G +R + KC+ + CP+ Sbjct: 95 CVCKKGFVRKTEFGKCIPLRLCPR 118 Score = 23.0 bits (47), Expect = 3.6 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = +1 Query: 109 CAFETICALRSAHSNRKHYCDCWCKPGLIRD 201 C T + + R YC C C+ G RD Sbjct: 222 CNQITCSGISTEVCRRSCYCGCQCRRGYDRD 252 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 19 NLWFVLLFIISC 54 N WFVLL II C Sbjct: 556 NTWFVLLTIIFC 567 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 104 QIAPSRQSVHYEAHTQTGNTTVT 172 Q APS H+ + + T TTVT Sbjct: 10 QSAPSPPHHHHSSQSPTSTTTVT 32 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 104 QIAPSRQSVHYEAHTQTGNTTVT 172 Q APS H+ + + T TTVT Sbjct: 10 QSAPSPPHHHHSSQSPTSTTTVT 32 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 22.2 bits (45), Expect = 6.4 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 13 KMNLWFVLLFIISCLGINSAECPPDQYDPG 102 K N+W VL + GI+ C PD G Sbjct: 124 KDNVWSVLQHLCIVEGISVGICCPDVVQDG 153 >AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive chymotrypsin-likeserine protease-related protein ISPR1 protein. Length = 187 Score = 22.2 bits (45), Expect = 6.4 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 1 VKRGKMNLWFVLLFIISCLGINSA 72 +KRGKM + + +++C+ SA Sbjct: 3 LKRGKMVVHIIFAILLACVSRGSA 26 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 22.2 bits (45), Expect = 6.4 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 238 YDEILDSYIIPISLLFGRIDDVIFYV 315 YD +LD + P + + G DD++ V Sbjct: 641 YDGVLDIALPPDAEILGYADDLVLLV 666 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 390,803 Number of Sequences: 2352 Number of extensions: 7948 Number of successful extensions: 23 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 27944475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -