BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30375 (659 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC622.11 |||LMBR1-like membrane protein|Schizosaccharomyces po... 27 1.8 SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2 alpha-1,... 25 9.7 SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 25 9.7 >SPCC622.11 |||LMBR1-like membrane protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 562 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +1 Query: 70 KFYGLIASLLFSPILFVTYQMFYRFRGQVRPRFVIHQYLNFV 195 KF A+ +F LFV Y + ++ +R +F H Y V Sbjct: 385 KFTNSSATSIFVSFLFVYYMRYCTYKSLMRTQFAPHYYYALV 426 >SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2 alpha-1,3-glucosyltransferase Alg12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 546 Score = 25.0 bits (52), Expect = 9.7 Identities = 18/62 (29%), Positives = 29/62 (46%) Frame = +1 Query: 94 LLFSPILFVTYQMFYRFRGQVRPRFVIHQYLNFVLTAAIKP*KCF*SCRQFKIDY*IFLL 273 L++ P+ F+ Y F G RF+I+ F +AI CF + + K + I L Sbjct: 284 LIYVPLFFI---FVYSFLGHKEWRFIIYSIPWFNAASAIGASLCFNASKFGKKIFEILRL 340 Query: 274 MY 279 M+ Sbjct: 341 MF 342 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 352 C*VFDILIIMYNYAFYNVNKTNCLHVHLFIS 444 C VF++L ++NYA Y N LH+ +I+ Sbjct: 1924 CLVFEVLHAVHNYAIYG----NYLHLEEYIN 1950 Score = 25.0 bits (52), Expect = 9.7 Identities = 16/69 (23%), Positives = 29/69 (42%) Frame = -1 Query: 617 YINIFNFQKKI*AKNTLHN*FTILEDTRSDRDLSRIKIY*TWWFXXXXYDNL*KCLYNEI 438 Y+ + F+ K+ ++ H + E +D +SR T W D L L + + Sbjct: 2236 YLRMSTFRSKMLTQSITHYLKCLSESDENDVLISRCC---TMWLSNSHLDELNNSLQHYL 2292 Query: 437 NKCTCKQFV 411 CK+F+ Sbjct: 2293 QNLPCKKFI 2301 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,422,096 Number of Sequences: 5004 Number of extensions: 48216 Number of successful extensions: 86 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -