BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30372X (373 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 1.6 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 24 2.1 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 3.7 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 23 4.9 L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase... 22 6.4 L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase... 22 6.4 AY994093-1|AAX86006.1| 45|Anopheles gambiae metallothionein 1 ... 22 6.4 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 22 6.4 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 22 6.4 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 22 6.4 AF513637-1|AAM53609.1| 214|Anopheles gambiae glutathione S-tran... 22 6.4 AF269156-1|AAF91401.1| 52|Anopheles gambiae transcription fact... 22 6.4 AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 22 8.5 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 24.2 bits (50), Expect = 1.6 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +1 Query: 16 LSQW--EKAHQYLFDANEAEAWMSEQELYMMVEDRGKD 123 L++W EK +F E +W E E+Y V R ++ Sbjct: 275 LAKWRDEKVAVKIFFTTEESSWFRETEIYQTVLMRNEN 312 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.8 bits (49), Expect = 2.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 273 SEVDKLYAGMKDLARERRAKLDEALRLLQLFR 368 +EV +LYA +A +L +LRLL L R Sbjct: 733 AEVRELYASNNSIAALAADQLPRSLRLLDLSR 764 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 3.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 66 GSLDERTGTLHDGGRSRQ 119 G + E +GT+ GGRS+Q Sbjct: 730 GDVIETSGTMSGGGRSQQ 747 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 22.6 bits (46), Expect = 4.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 46 LFDANEAEAWMSEQELYMMVEDR 114 ++DAN + +S+Q YM+ D+ Sbjct: 511 IYDANGEQLLLSQQRRYMLEMDK 533 >L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 22.2 bits (45), Expect = 6.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 315 EPSPSFPHTTCLLLIVSRKXVTEWMF 238 EP S PH +LL+ +T+W + Sbjct: 286 EPRFSQPHQLLMLLMDIDSLITKWRY 311 >L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 22.2 bits (45), Expect = 6.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 315 EPSPSFPHTTCLLLIVSRKXVTEWMF 238 EP S PH +LL+ +T+W + Sbjct: 286 EPRFSQPHQLLMLLMDIDSLITKWRY 311 >AY994093-1|AAX86006.1| 45|Anopheles gambiae metallothionein 1 protein. Length = 45 Score = 22.2 bits (45), Expect = 6.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 Query: 49 TGTGVLSPIATDCSC 5 +G G P ATDC C Sbjct: 14 SGCGSGQPCATDCKC 28 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 22.2 bits (45), Expect = 6.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 176 TACSKISCFFMRFCAEISSLPRSST 102 TA + ISC + C EIS +P +T Sbjct: 414 TANTSISCSCLPGCFEISYVPDLTT 438 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 22.2 bits (45), Expect = 6.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 176 TACSKISCFFMRFCAEISSLPRSST 102 TA + ISC + C EIS +P +T Sbjct: 414 TANTSISCSCLPGCFEISYVPDLTT 438 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 22.2 bits (45), Expect = 6.4 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 5/60 (8%) Frame = +1 Query: 73 WMSEQELYMMVEDRGKDEISAQNL-----MKKHEILEQAVDDYAQTIRQLGETVRQLTAE 237 W ++E V R + E +N+ +H++ ++ V YAQ LG+ V + E Sbjct: 420 WQRQREAEEAVLTRREYEERLRNIDVTFGFDRHKVADKTVKTYAQRKLLLGQMVEKEVRE 479 >AF513637-1|AAM53609.1| 214|Anopheles gambiae glutathione S-transferase D11 protein. Length = 214 Score = 22.2 bits (45), Expect = 6.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 303 KDLARERRAKLDEALRLLQLF 365 K+L E KLDEAL L+ F Sbjct: 120 KELNPELVVKLDEALEFLESF 140 >AF269156-1|AAF91401.1| 52|Anopheles gambiae transcription factor zen protein. Length = 52 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 113 RSSTIM*SSCSLIQASASFASNRYWC 36 RS T SS L++ F SNRY C Sbjct: 2 RSRTAFTSS-QLVELEKEFHSNRYLC 26 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 21.8 bits (44), Expect = 8.5 Identities = 5/19 (26%), Positives = 14/19 (73%) Frame = +1 Query: 46 LFDANEAEAWMSEQELYMM 102 +F E ++W++EQ+++ + Sbjct: 148 IFPMQERQSWITEQDIFKL 166 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 379,929 Number of Sequences: 2352 Number of extensions: 6664 Number of successful extensions: 23 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 28374390 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -