BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30372X (373 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 26 0.12 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 23 1.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 2.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 2.0 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 3.5 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 3.5 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.7 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.7 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.7 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 21 6.2 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 21 6.2 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 21 6.2 AB083209-1|BAC54133.1| 87|Apis mellifera hypothetical protein ... 21 6.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 6.2 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 20 8.2 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 26.2 bits (55), Expect = 0.12 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 351 IVKLHPAWLVFREPSPSFPHTTCLLLIV 268 ++ + WLV+ EP+PS + LL I+ Sbjct: 30 LIHIPEHWLVYPEPNPSLHYLLALLYIL 57 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 23.0 bits (47), Expect = 1.2 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 97 MMVEDRGKDEISAQNLMKKHEILE 168 M+ E +G DE+ A ++KK I++ Sbjct: 1 MLAERKGTDELYAIKILKKDIIIQ 24 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 329 GSSFASQV-LHSRIQLVYF*LFHENXSLSGCSS 234 G++ AS LH L++ ++HE+ GC+S Sbjct: 1721 GAAEASAAGLHPNNTLLHSFMYHEHAMTEGCAS 1753 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 2.0 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 329 GSSFASQV-LHSRIQLVYF*LFHENXSLSGCSS 234 G++ AS LH L++ ++HE+ GC+S Sbjct: 1717 GAAEASAAGLHPNNTLLHSFMYHEHAMTEGCAS 1749 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 3.5 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +1 Query: 73 WMSEQELYMMVEDRGKDEISAQNLMKKHEILEQAVDDYAQT 195 WMS + +M E RG+ + LE+ +D +T Sbjct: 244 WMSSSQYHMPKEIRGQLYYFLHKQLMTRYFLERMSNDLGKT 284 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 3.5 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +1 Query: 73 WMSEQELYMMVEDRGKDEISAQNLMKKHEILEQAVDDYAQT 195 WMS + +M E RG+ + LE+ +D +T Sbjct: 244 WMSSSQYHMPKEIRGQLYYFLHKQLMTRYFLERMSNDLGKT 284 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 21.0 bits (42), Expect = 4.7 Identities = 15/63 (23%), Positives = 29/63 (46%) Frame = -2 Query: 216 SLSQLTDSLRVIVDSLLQNLVFLHEVLRGDLILASIFHHHVEFLFAHPGFRFVRIEQVLV 37 +L Q++D++ ++ S ++F+ +L IFHH + P + + Q L Sbjct: 246 TLPQVSDAIPLL-GSYFNCIMFMVASSVVLTVLVLIFHHRTPDRYVMPSWIKMLFLQWLP 304 Query: 36 CFL 28 C L Sbjct: 305 CLL 307 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 21.0 bits (42), Expect = 4.7 Identities = 15/63 (23%), Positives = 29/63 (46%) Frame = -2 Query: 216 SLSQLTDSLRVIVDSLLQNLVFLHEVLRGDLILASIFHHHVEFLFAHPGFRFVRIEQVLV 37 +L Q++D++ ++ S ++F+ +L IFHH + P + + Q L Sbjct: 246 TLPQVSDAIPLL-GSYFNCIMFMVASSVVLTVLVLIFHHRTPDRYVMPSWIKMLFLQWLP 304 Query: 36 CFL 28 C L Sbjct: 305 CLL 307 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.0 bits (42), Expect = 4.7 Identities = 15/63 (23%), Positives = 29/63 (46%) Frame = -2 Query: 216 SLSQLTDSLRVIVDSLLQNLVFLHEVLRGDLILASIFHHHVEFLFAHPGFRFVRIEQVLV 37 +L Q++D++ ++ S ++F+ +L IFHH + P + + Q L Sbjct: 246 TLPQVSDAIPLL-GSYFNCIMFMVASSVVLTVLVLIFHHRTPDRYVMPSWIKMLFLQWLP 304 Query: 36 CFL 28 C L Sbjct: 305 CLL 307 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 20.6 bits (41), Expect = 6.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -2 Query: 123 ILASIFHHHVEFLFAHPGFRFVRIEQVLVCFL 28 +L IFHH + P + + Q L C L Sbjct: 276 VLVLIFHHRTPDRYVMPSWIKMLFLQWLPCLL 307 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 20.6 bits (41), Expect = 6.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -2 Query: 123 ILASIFHHHVEFLFAHPGFRFVRIEQVLVCFL 28 +L IFHH + P + + Q L C L Sbjct: 276 VLVLIFHHRTPDRYVMPSWIKMLFLQWLPCLL 307 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 20.6 bits (41), Expect = 6.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -2 Query: 123 ILASIFHHHVEFLFAHPGFRFVRIEQVLVCFL 28 +L IFHH + P + + Q L C L Sbjct: 276 VLVLIFHHRTPDRYVMPSWIKMLFLQWLPCLL 307 >AB083209-1|BAC54133.1| 87|Apis mellifera hypothetical protein protein. Length = 87 Score = 20.6 bits (41), Expect = 6.2 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 181 DYAQTIRQLGETVRQLTAEEHPLSD 255 DY+Q G +RQ A P S+ Sbjct: 21 DYSQLFAGFGPYIRQAVAMRDPRSN 45 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.6 bits (41), Expect = 6.2 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 33 STPVPVRCERSGSLDE 80 S P P+ R+GS DE Sbjct: 1396 SPPTPLSISRAGSRDE 1411 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 20.2 bits (40), Expect = 8.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 68 SASFASNRYWCAFS 27 S FAS RY+ A+S Sbjct: 426 SQRFASGRYYSAYS 439 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,485 Number of Sequences: 438 Number of extensions: 2140 Number of successful extensions: 19 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8928360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -