BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30372X (373 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi... 29 0.99 At5g59390.1 68418.m07442 XH/XS domain-containing protein contain... 28 1.7 At1g21700.1 68414.m02717 SWIRM domain-containing protein / DNA-b... 28 2.3 At5g51430.1 68418.m06376 conserved oligomeric Golgi complex comp... 27 4.0 At4g17770.1 68417.m02652 glycosyl transferase family 20 protein ... 27 4.0 At1g75790.1 68414.m08803 multi-copper oxidase type I family prot... 27 4.0 At3g11070.1 68416.m01337 outer membrane OMP85 family protein con... 27 5.3 At4g27260.1 68417.m03913 auxin-responsive GH3 family protein sim... 26 7.0 At3g44790.1 68416.m04823 meprin and TRAF homology domain-contain... 26 7.0 At3g14075.1 68416.m01778 lipase class 3 family protein low simil... 26 7.0 At2g46535.1 68415.m05804 expressed protein 26 7.0 At5g60250.1 68418.m07552 zinc finger (C3HC4-type RING finger) fa... 26 9.2 At5g54510.1 68418.m06787 auxin-responsive GH3 protein, putative ... 26 9.2 At4g37390.1 68417.m05294 auxin-responsive GH3 family protein sim... 26 9.2 At3g60200.1 68416.m06726 expressed protein hypothetical proteins... 26 9.2 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 26 9.2 >At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 682 Score = 29.1 bits (62), Expect = 0.99 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = -2 Query: 282 LLLIVSRKXVTEWMFFGSELPNSLSQLTDSLRVIVDSLLQNLVFLHEVLRGDLILASI-- 109 L L + + +W SE+ +++ DS +V + + LH++ DL ++SI Sbjct: 324 LRLCTEARKIGDWRTVISEIDAAIANGADSSPQLVACKAEAFLRLHQIKDSDLCISSIPR 383 Query: 108 -FHHHVE 91 HHH + Sbjct: 384 LDHHHTQ 390 >At5g59390.1 68418.m07442 XH/XS domain-containing protein contains Pfam domain PF03469: XH domain and PF03468: XS domain Length = 561 Score = 28.3 bits (60), Expect = 1.7 Identities = 15/67 (22%), Positives = 33/67 (49%) Frame = +1 Query: 25 WEKAHQYLFDANEAEAWMSEQELYMMVEDRGKDEISAQNLMKKHEILEQAVDDYAQTIRQ 204 WEK H+ L D N+ W++ ++ Y + GK+ ++L +I+E+ + Sbjct: 121 WEKGHR-LRD-NKLYGWVAREDDYNRSDTVGKNVKKKRDLKSISQIVEEDERKMVHLVEN 178 Query: 205 LGETVRQ 225 + +T+ + Sbjct: 179 MSQTIEK 185 >At1g21700.1 68414.m02717 SWIRM domain-containing protein / DNA-binding family protein contains similarity to SWI/SNF complex 170 KDa subunit [Homo sapiens] gi|1549241|gb|AAC50694; contains Pfam domain PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain Length = 807 Score = 27.9 bits (59), Expect = 2.3 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -2 Query: 156 VFLHEVLRGDLILASIFHHHVEFLFAHPGFRFVRIE 49 V+ +GD++L HH F+ H FVR++ Sbjct: 355 VYFQSQKKGDILLCCDCFHHGRFVVGHSCLDFVRVD 390 >At5g51430.1 68418.m06376 conserved oligomeric Golgi complex component-related / COG complex component-related contains weak similarity to Conserved oligomeric Golgi complex component 7 (Swiss-Prot:P83436) [Homo sapiens] Length = 836 Score = 27.1 bits (57), Expect = 4.0 Identities = 12/32 (37%), Positives = 22/32 (68%), Gaps = 4/32 (12%) Frame = +2 Query: 251 VTXFRETIRSRQVVCG----NEGLGSRKTSQA 334 ++ +ET++S +VVCG +G+GS+K + A Sbjct: 490 ISMLQETLKSLRVVCGVDGTGDGVGSKKDASA 521 >At4g17770.1 68417.m02652 glycosyl transferase family 20 protein / trehalose-phosphatase family protein contains Pfam profile: PF02358 trehalose-phosphatase Length = 862 Score = 27.1 bits (57), Expect = 4.0 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = -1 Query: 118 CLDLPPSC---RVPVRSSRLPLRSHRTGTGVLS 29 C D P S R+ + ++LP++SHR G LS Sbjct: 50 CSDAPSSVTQDRIIIVGNQLPIKSHRNSAGKLS 82 >At1g75790.1 68414.m08803 multi-copper oxidase type I family protein contains Pfam profile: PF00394 Multicopper oxidase Length = 545 Score = 27.1 bits (57), Expect = 4.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 55 ANEAEAWMSEQELYMMVEDRGKDEIS 132 + +AE W QELYM V+ G+++ S Sbjct: 499 SQKAEQWYLGQELYMRVKGEGEEDPS 524 >At3g11070.1 68416.m01337 outer membrane OMP85 family protein contains Pfam profile PF01103: outer membrane protein, OMP85 family Length = 520 Score = 26.6 bits (56), Expect = 5.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 99 DGGRSRQG*DLRAEPHEETRDFGASCRRLRAD 194 DGG G D E +TR+ G+S R++A+ Sbjct: 33 DGGEDDDGEDDDTESKSQTRESGSSVDRIKAE 64 >At4g27260.1 68417.m03913 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 612 Score = 26.2 bits (55), Expect = 7.0 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -2 Query: 222 PNSLSQLTDSLRVIVDSLLQNLVFLHEVLRGDLILASIFHHHVEFLFAH 76 PN +DS + + +L L EVLR + AS F ++FL H Sbjct: 198 PNETILCSDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKH 246 >At3g44790.1 68416.m04823 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 324 Score = 26.2 bits (55), Expect = 7.0 Identities = 15/53 (28%), Positives = 31/53 (58%) Frame = +1 Query: 10 NNLSQWEKAHQYLFDANEAEAWMSEQELYMMVEDRGKDEISAQNLMKKHEILE 168 ++L Q EKA +YL D++ W+ E++L + E + +++I + + E L+ Sbjct: 224 DDLGQAEKALRYLKDSDFKVDWL-ERKLEEVKEKKMEEQIGKSRMQELEEELK 275 >At3g14075.1 68416.m01778 lipase class 3 family protein low similarity to calmodulin-binding heat-shock protein CaMBP [Nicotiana tabacum] GI:1087073; contains Pfam profile PF01764: Lipase, PF03893: Lipase 3 N-terminal region Length = 642 Score = 26.2 bits (55), Expect = 7.0 Identities = 10/42 (23%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = +1 Query: 127 ISAQNLMKKHEILEQAVDDYAQTI--RQLGETVRQLTAEEHP 246 ++ ++L K + ++ + D+ + RQ+ +++LT E+HP Sbjct: 601 LTPRSLYSKVRLSQRMISDHFMPVYRRQIERLIQELTVEQHP 642 >At2g46535.1 68415.m05804 expressed protein Length = 175 Score = 26.2 bits (55), Expect = 7.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 118 CLDLPPSCRVPVRSSRLPLRSHRTG 44 CLDLPP +P +++PL + G Sbjct: 68 CLDLPPRLLLPGEFTQMPLPERKHG 92 >At5g60250.1 68418.m07552 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature and Pfam domain PF01485: IBR domain Length = 655 Score = 25.8 bits (54), Expect = 9.2 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 57 ERSGSLDERTGTLHDGGRSRQG*DLRA 137 +R L E G L D G SRQG +L+A Sbjct: 176 QRDNLLFEMKGPLIDNGMSRQGAELKA 202 >At5g54510.1 68418.m06787 auxin-responsive GH3 protein, putative (DFL-1) identical to auxin-responsive GH3 homologue [Arabidopsis thaliana] GI:11041726; similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 612 Score = 25.8 bits (54), Expect = 9.2 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -2 Query: 222 PNSLSQLTDSLRVIVDSLLQNLVFLHEVLRGDLILASIFHHHVEFLFAH 76 PN +DS + + +L L EVLR + AS F ++FL H Sbjct: 198 PNQTILCSDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKH 246 >At4g37390.1 68417.m05294 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 603 Score = 25.8 bits (54), Expect = 9.2 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = -2 Query: 222 PNSLSQLTDSLRVIVDSLLQNLVFLHEVLRGDLILASIFHHHVEFL 85 PN +DS + + +L L+ HEVLR + AS + FL Sbjct: 197 PNEAILCSDSSQSMYAQMLCGLLMRHEVLRLGAVFASGLLRAISFL 242 >At3g60200.1 68416.m06726 expressed protein hypothetical proteins At2g44600 - Arabidopsis thaliana, EMBL:AAC27462 Length = 305 Score = 25.8 bits (54), Expect = 9.2 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -3 Query: 167 SKISCFFMRFCAEISSLPRSSTIM*SSCSLIQASASFASNRYW 39 S+ S F + + P+S+ SSC + S+S +S+R W Sbjct: 118 SRFSNLFRARSEDFDTNPKSNNPRFSSCDASEISSSSSSSRSW 160 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 25.8 bits (54), Expect = 9.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 99 DGGRSRQG*DLRAEPHEETRDFGASCR 179 DGGR R G DL+ E+ F CR Sbjct: 86 DGGRGRGGSDLKCYECGESGHFARECR 112 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,101,446 Number of Sequences: 28952 Number of extensions: 149799 Number of successful extensions: 602 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 497853200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -