BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30371 (601 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 25 1.4 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 24 4.3 AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismuta... 24 4.3 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 24 4.3 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 23 7.5 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 25.4 bits (53), Expect = 1.4 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 151 RSPDITNNESSVSNILETSNIEEIHLKSAETPKEVK*VMWKRT 279 R P T++E S ++I T + ++ L A PK V W+R+ Sbjct: 418 RLPAYTSSELSFNDI--TVDSFDVQLNKANAPKNVLLTFWQRS 458 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.8 bits (49), Expect = 4.3 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -2 Query: 72 SLPFPYPYSR*L---YIYYLGVFFK 7 SLPF YP+ R + Y Y ++FK Sbjct: 652 SLPFGYPFDRVINFNYFYTKNMYFK 676 >AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismutase 1 protein. Length = 206 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/50 (24%), Positives = 26/50 (52%) Frame = +1 Query: 76 LLMCQKVLFSYILSCTAIEGLKMVYRSPDITNNESSVSNILETSNIEEIH 225 +L + LFS +C+A+ G + + PD+ + ++ ++ I E+H Sbjct: 10 MLAVRGALFSTAKNCSAVLGCRSKHTLPDLPYDFGALEPVI-CREIMELH 58 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.8 bits (49), Expect = 4.3 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -2 Query: 72 SLPFPYPYSR*L---YIYYLGVFFK 7 SLPF YP+ R + Y Y ++FK Sbjct: 652 SLPFGYPFDRVINFNYFYTKNMYFK 676 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 160 DITNNESSVSNILETSNIEEIHLKSAETPKEV 255 + ++SV + + IE +HL TP+EV Sbjct: 180 EAVKGKASVRTLAPSKMIEIMHLDEITTPEEV 211 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 573,122 Number of Sequences: 2352 Number of extensions: 10631 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -