BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30371 (601 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF040643-2|AAB94961.1| 471|Caenorhabditis elegans Hypothetical ... 31 0.63 U70854-12|AAB09150.1| 263|Caenorhabditis elegans Hypothetical p... 27 7.7 AF067621-1|AAC17540.2| 4368|Caenorhabditis elegans Hypothetical ... 27 7.7 >AF040643-2|AAB94961.1| 471|Caenorhabditis elegans Hypothetical protein F14D2.7 protein. Length = 471 Score = 31.1 bits (67), Expect = 0.63 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = -3 Query: 209 LLVSRIFDTLDSLFVISGDRYTILSPSIAVQLN 111 L ++ +DS FVI+GD++TIL P+ ++N Sbjct: 302 LTEGKLMTHIDSCFVITGDQFTILRPNEHFKIN 334 >U70854-12|AAB09150.1| 263|Caenorhabditis elegans Hypothetical protein F38A5.6 protein. Length = 263 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +1 Query: 163 ITNNESSVSNILETSNIEEIHLKSAETPKEVK 258 + +N +++N+L + H+KS++T KEVK Sbjct: 162 LNSNVENLNNLLHAIDDSRHHVKSSKTTKEVK 193 >AF067621-1|AAC17540.2| 4368|Caenorhabditis elegans Hypothetical protein F55F10.1 protein. Length = 4368 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +3 Query: 255 QIGDVEEDNNLQLESIMHDEIEELLTKTNEENQE 356 Q+GDVEE++ QL+ M DE EE + ++N + Sbjct: 3704 QMGDVEEEDEKQLDPKMWDE-EEKEEQDQQKNMD 3736 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,657,233 Number of Sequences: 27780 Number of extensions: 247126 Number of successful extensions: 699 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -