BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30371 (601 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03280.1 68418.m00277 ethylene-insensitive 2 (EIN2) identical... 30 1.3 At1g20070.1 68414.m02512 expressed protein 30 1.3 At5g17960.1 68418.m02106 DC1 domain-containing protein contains ... 29 3.1 At1g44120.1 68414.m05096 C2 domain-containing protein / armadill... 29 3.1 >At5g03280.1 68418.m00277 ethylene-insensitive 2 (EIN2) identical to EIN2 [Arabidopsis thaliana] gi|5231113|gb|AAD41076; member of the natural resistance-associated macrophage protein (NRAMP) metal transporter family, PMID:11500563; metal transport capacity has not been shown, PMID:11500563, PMID:1038174 Length = 1294 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 222 PFEICRNTERSQIGDVEEDNNLQLESIMHDEIEELLTKTNEE 347 P + N +QI +++ N L S+ +EIE T+ NE+ Sbjct: 460 PLKSASNRAEAQIWNMDAQNALSYPSVQEEEIERTETRRNED 501 >At1g20070.1 68414.m02512 expressed protein Length = 193 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 136 LKMVYRSPDITNNESSVSNILETSNIEEIHLKSAE 240 L+ V S NN SS++ + +T I E H+K AE Sbjct: 79 LQRVNSSRPRVNNNSSLNRVAQTKAISETHMKKAE 113 >At5g17960.1 68418.m02106 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 599 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -2 Query: 279 CPLPHHLFDFFRCFCRFQMDFF-NITC 202 C LP HL DF++C Q DFF ++ C Sbjct: 338 CVLPIHLHDFYKC---MQCDFFLHVVC 361 >At1g44120.1 68414.m05096 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2114 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/41 (34%), Positives = 27/41 (65%) Frame = +1 Query: 121 TAIEGLKMVYRSPDITNNESSVSNILETSNIEEIHLKSAET 243 T E L+ ++RSP+IT +++++S++ + I +HL S T Sbjct: 1215 TVSELLESLFRSPEITRHKTAISSMKQLIGI--LHLASRST 1253 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,594,825 Number of Sequences: 28952 Number of extensions: 214426 Number of successful extensions: 475 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 475 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -