BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30370 (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10252| Best HMM Match : tRNA-synt_2b (HMM E-Value=3.2e-32) 125 3e-29 SB_20525| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) 29 2.6 SB_28946| Best HMM Match : Occludin_ELL (HMM E-Value=0.27) 29 4.5 SB_33426| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_40929| Best HMM Match : Attractin (HMM E-Value=5.1) 28 7.9 SB_9228| Best HMM Match : GoLoco (HMM E-Value=4.2) 28 7.9 SB_22131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_10252| Best HMM Match : tRNA-synt_2b (HMM E-Value=3.2e-32) Length = 734 Score = 125 bits (302), Expect = 3e-29 Identities = 53/74 (71%), Positives = 64/74 (86%) Frame = +3 Query: 39 QAVFWHSSAHMLGEAMERVYGGCLCYGPPIEEGFYYDMYYPEKGISSTDFNVLEGLIKKI 218 +AVFWHSSAH+LGEAMER YGGCLCYGPPIEEG+YYDM+ + +SS DF+ L+ L KKI Sbjct: 290 RAVFWHSSAHVLGEAMERHYGGCLCYGPPIEEGYYYDMHLEGRQVSSNDFSSLDNLTKKI 349 Query: 219 AKEKQPFERLELQR 260 KEKQPFERLE+++ Sbjct: 350 TKEKQPFERLEMKK 363 Score = 71.3 bits (167), Expect = 7e-13 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +1 Query: 538 EAAKRDHRKIGREQELFFFHELSPGSCFFQPRGAHIYNTLVNFIK 672 E K D ++ ++QELFFFHELSPGSCFF P+GA IYNTL+NFIK Sbjct: 360 EMKKEDLLEMFKDQELFFFHELSPGSCFFLPKGAVIYNTLINFIK 404 >SB_20525| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) Length = 1145 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +2 Query: 335 TTVYRXGPLIDLCRGPHVRHTGKVKALKVTKNSATYWEGKAEAQSLQRVYGIS 493 T R G LI +G H+ K++ L K + T EGK + ++ VYG++ Sbjct: 750 TAAARRGSLIK--KGEHLETLAKLEVLAFDK-TGTLTEGKFQVTDMESVYGVN 799 >SB_28946| Best HMM Match : Occludin_ELL (HMM E-Value=0.27) Length = 396 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 470 LQRVYGISFPEPKS*KNGRSFKRRPPSVTTERLEGNKSYSSSTN 601 L+ G S +P S K S K+ PP++ +R + SY+S N Sbjct: 231 LKPTEGESSSQPSSAKTSPSKKQEPPALGNKRQSSSISYASPAN 274 >SB_33426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 443 WEGKAEAQSLQRVYGISFP 499 W G+AEA +LQ+ Y IS P Sbjct: 116 WPGRAEATALQKAYTISCP 134 >SB_40929| Best HMM Match : Attractin (HMM E-Value=5.1) Length = 566 Score = 27.9 bits (59), Expect = 7.9 Identities = 29/122 (23%), Positives = 46/122 (37%) Frame = +2 Query: 182 RFQRTRRANKKNCKRKTAL*TFRTTKEQLLEMFDYNPFKVRILNEKVQTPTTTVYRXGPL 361 R RT +A++KN K +TTK Q + D P + R +T T+ R P Sbjct: 140 RQARTSQASRKNKPSKNKPSKNKTTKPQDQDKQDARPRQARPREASRKTKTSKTKRSKPQ 199 Query: 362 IDLCRGPHVRHTGKVKALKVTKNSATYWEGKAEAQSLQRVYGISFPEPKS*KNGRSFKRR 541 R T K K + + ++ E Q+ ++ + K+ K R K Sbjct: 200 DKQAERQASRKTSKPKDKQAARQASRKTSKPQEKQAARQASSKTKTSRKT-KTSRKTKTS 258 Query: 542 PP 547 P Sbjct: 259 KP 260 >SB_9228| Best HMM Match : GoLoco (HMM E-Value=4.2) Length = 171 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/54 (29%), Positives = 30/54 (55%) Frame = +2 Query: 476 RVYGISFPEPKS*KNGRSFKRRPPSVTTERLEGNKSYSSSTNCLPARVSSSHVE 637 + + +S P S K +S+K +VTT+R + + S SSS++ + + SS + Sbjct: 103 QAWDVSKPTGPSYKQSKSYKNST-TVTTKRSQASPSSSSSSSSVNSTAGSSRTK 155 >SB_22131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = -1 Query: 626 WKK--HEPGDSSWKKNNSCS 573 WKK +E G++ WK+N CS Sbjct: 40 WKKEIYEQGEAQWKENKECS 59 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,184,448 Number of Sequences: 59808 Number of extensions: 430447 Number of successful extensions: 1355 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1355 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -