BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30370 (674 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 2.2 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 24 5.0 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 24 5.0 AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. 24 5.0 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 5.0 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 6.7 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.0 bits (52), Expect = 2.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 577 VPFQSFCGHAWRPPLE 530 +PF+SF G W PL+ Sbjct: 452 IPFESFFGRGWSLPLD 467 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 54 HSSAHMLGEAMERVYGGCLCYGPPIEEGFYYDMY 155 H + + EA +R+YG + G E YY Y Sbjct: 409 HLNNEHVFEAFDRIYGNKINIGNTYAEEHYYRRY 442 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 54 HSSAHMLGEAMERVYGGCLCYGPPIEEGFYYDMY 155 H + + EA +R+YG + G E YY Y Sbjct: 409 HLNNEHVFEAFDRIYGNKINIGNTYAEEHYYRRY 442 >AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. Length = 179 Score = 23.8 bits (49), Expect = 5.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 597 RTVSRLVFLPATWSSHLQH 653 R V+RL F+P +W L H Sbjct: 105 RIVARLPFVPISWIQGLSH 123 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 669 NEIHECVVNVSSTWLEETRAGRQFVEE 589 NE C N+S+ LEE R R +E+ Sbjct: 357 NETRVCGENISTFQLEERRRRRTVIEK 383 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.4 bits (48), Expect = 6.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 535 EEAAKRDHRKIGREQELFFFHELSPGSCFFQPRGAH 642 +E+ K K+ E+ L E PG+CFF + H Sbjct: 49 DESEKLYGGKVQEERVLKAKSESKPGACFFCGQPGH 84 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 709,845 Number of Sequences: 2352 Number of extensions: 14834 Number of successful extensions: 32 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -