BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30369 (394 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 33 0.001 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 25 0.36 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 3.3 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 5.8 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 33.1 bits (72), Expect = 0.001 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +3 Query: 141 YGSFQLFNKILLLM*RTGYCIYFHALLVCSLLHFCYYILFLL 266 Y +F LF LLL+ Y Y H L C+ + F ++LFLL Sbjct: 242 YYAFILFTVHLLLLVCIYYFYYMHLLFCCAFIIFTMHLLFLL 283 Score = 21.4 bits (43), Expect = 3.3 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +3 Query: 141 YGSFQLFNKILLLM*RTGYCIYFHAL----LVCSLLHFCYYILF 260 Y +F +F LL + CIY+ + L+C +C +I+F Sbjct: 117 YYAFIIFTVHLLFL----LCIYYFVVPLFFLLCIYYFYCAFIIF 156 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 24.6 bits (51), Expect = 0.36 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 153 QLFNKILLLM*RTGYCIYFHALLVCSLLHFCYYILFL 263 +L K +++M +G I+ + +CSL+H + FL Sbjct: 1151 KLVIKAIIIMILSGCIIFTEGIWICSLIHRKKIVKFL 1187 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 3.3 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 227 FIVAFLLLHFISTSSLAVCLDLNNSHYRR 313 F VA L + S VC + SH+R+ Sbjct: 10 FAVATLFAAYCKAESKVVCYYDSKSHFRQ 38 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 20.6 bits (41), Expect = 5.8 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 218 ISMFIVAFLLLHFISTSSL 274 + FIV F+ HF T L Sbjct: 79 LEQFIVRFMKYHFFGTLKL 97 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,187 Number of Sequences: 336 Number of extensions: 1595 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8330471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -