BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30369 (394 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_1028 + 22414928-22415154,22415374-22415558,22416001-22416056 30 0.58 06_03_0436 + 20755816-20756025,20756124-20756240,20756942-207571... 26 9.4 >10_08_1028 + 22414928-22415154,22415374-22415558,22416001-22416056 Length = 155 Score = 30.3 bits (65), Expect = 0.58 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 197 LHLFPCIISM-FIVAFLLLHFISTSSLAVCLDLNNSHYRRP 316 +H+ P + + F+V FLL H ++SSLA+ N RP Sbjct: 44 IHIIPVLTLLCFLVLFLLSHDPASSSLAIATGRGNDGVHRP 84 >06_03_0436 + 20755816-20756025,20756124-20756240,20756942-20757137, 20757393-20757544,20757653-20757736,20757848-20757925, 20757958-20758116,20758219-20758251,20759119-20759826, 20759917-20759998,20760093-20760449,20760586-20760692, 20760796-20761001,20761480-20761623,20761715-20761800, 20762120-20762283,20762559-20763119 Length = 1147 Score = 26.2 bits (55), Expect = 9.4 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -3 Query: 134 LNYSLLGRYFYLSGGLSV*LKILQFV 57 LNY LL Y YLSG + V +I F+ Sbjct: 653 LNYQLLILYAYLSGNIRVHCRIRPFL 678 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,798,190 Number of Sequences: 37544 Number of extensions: 123227 Number of successful extensions: 174 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 672845152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -