BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30369 (394 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14294| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.58 SB_35377| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 27 5.4 SB_25887| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 27 5.4 SB_5297| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.5 >SB_14294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 30.3 bits (65), Expect = 0.58 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +2 Query: 230 IVAFL-LLHFISTSSLAVCLDLNNSHYRRPLFISTTMLQF 346 +VAF ++ F ++++ VC L N HYRR + S L F Sbjct: 284 VVAFCNIMTFANSAANPVCYTLLNDHYRREIIYSLRKLTF 323 >SB_35377| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1400 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = -2 Query: 258 IKCNSKNATMNILIMHGNKCNNQFATSIAIFY*IIGMTHISFK 130 + C K++T N + K + + Y + +HISFK Sbjct: 386 VYCKGKHSTHNCATVSDPKARKDIVVKLRLCYNCLSSSHISFK 428 >SB_25887| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1378 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = -2 Query: 258 IKCNSKNATMNILIMHGNKCNNQFATSIAIFY*IIGMTHISFK 130 + C K++T N + K + + Y + +HISFK Sbjct: 365 VYCKGKHSTHNCATVSDPKARKDIVVKLRLCYNCLSSSHISFK 407 >SB_5297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 26.2 bits (55), Expect = 9.5 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 218 ISMFIVAFLLLHFISTSSLAVCLDLNNS 301 + + I F +LH +STSSL V D N S Sbjct: 7 LPLCIYVFCILHCVSTSSLRVKADNNPS 34 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,441,228 Number of Sequences: 59808 Number of extensions: 157756 Number of successful extensions: 225 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 225 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 678472135 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -