BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30369 (394 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125442-7|AAD12796.1| 203|Caenorhabditis elegans Hypothetical ... 28 2.7 AL132904-15|CAC35848.2| 518|Caenorhabditis elegans Hypothetical... 26 8.4 >AF125442-7|AAD12796.1| 203|Caenorhabditis elegans Hypothetical protein H04M03.11 protein. Length = 203 Score = 27.9 bits (59), Expect = 2.7 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 137 HLNYSLLGRYF--YLSGGLSV*LKILQFVLKLMI*IRQSDHS 18 H NY+ YF Y+ GG+ V L ++ VL + I + DHS Sbjct: 43 HENYNRKSSYFLHYILGGILVVLCLISIVLFIKICEMKKDHS 84 >AL132904-15|CAC35848.2| 518|Caenorhabditis elegans Hypothetical protein Y111B2A.19 protein. Length = 518 Score = 26.2 bits (55), Expect = 8.4 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 159 FNKILLLM*RTGYCIYFHALLVCSLLHFCYYILFLLVR 272 +N+ +L++ TG CI+ A+ S +Y LFLL R Sbjct: 86 YNRKMLMI--TGICIWILAVFASSFCGEGHYYLFLLCR 121 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,450,323 Number of Sequences: 27780 Number of extensions: 130380 Number of successful extensions: 262 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 262 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 598330768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -