BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30369 (394 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59930.1 68418.m07515 DC1 domain-containing protein / UV-B li... 28 2.0 At3g47980.1 68416.m05231 integral membrane HPP family protein co... 27 4.5 >At5g59930.1 68418.m07515 DC1 domain-containing protein / UV-B light-insensitive protein, putative similar to ULI3 (UV-B light insensitive) [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 656 Score = 28.3 bits (60), Expect = 2.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 171 LLLM*RTGYCIYFHALLVCSLLHFCYYI 254 ++L R G +YF C L+HF YY+ Sbjct: 629 VILKFREGNIVYFFCSRSCFLMHFSYYL 656 >At3g47980.1 68416.m05231 integral membrane HPP family protein contains Pfam domain, PF04982: HPP family Length = 252 Score = 27.1 bits (57), Expect = 4.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 221 SMFIVAFLLLHFISTSSLAVCLDLNNSHYR 310 SM V F HF+ SS +C+D + H R Sbjct: 26 SMVTVGFKRHHFLGVSSYGLCIDESVRHMR 55 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,778,635 Number of Sequences: 28952 Number of extensions: 113713 Number of successful extensions: 145 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 567552648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -