BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30368 (679 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC8E11.10 |||sorbose reductase |Schizosaccharomyces pombe|chr ... 33 0.029 SPBP23A10.11c |||conserved fungal protein|Schizosaccharomyces po... 31 0.15 SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha... 29 0.62 SPAC23H3.04 |||conserved fungal protein|Schizosaccharomyces pomb... 27 2.5 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 27 2.5 SPAC56F8.12 |||conserved fungal protein|Schizosaccharomyces pomb... 27 3.3 SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Sc... 26 4.4 SPAC19E9.01c |nup40||nucleoporin Nup40|Schizosaccharomyces pombe... 25 7.6 SPBC1683.04 |||glycosyl hydrolase family 3|Schizosaccharomyces p... 25 7.6 >SPAC8E11.10 |||sorbose reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 255 Score = 33.5 bits (73), Expect = 0.029 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +1 Query: 55 MLAASAGVV--ELSADTSNQDLEEKLYNSILTGDYDSAVRQSLEYESQGKGSII 210 ++ A+AG+ LS + N+D+ K+ L G Y +A ++ QGKGS+I Sbjct: 91 VMIANAGIAIPHLSLEDKNEDIWTKVVGINLNGAYYTAQAAGHHFKKQGKGSLI 144 >SPBP23A10.11c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 31.1 bits (67), Expect = 0.15 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 515 HNTKYNQYLKMSTTTCNCNSRDRVVYGGNSADSTRE 622 +++ YN+ M T++C+C+S + YGGN A E Sbjct: 47 YSSTYNEITNMDTSSCSCSSTPK-SYGGNLAPFDEE 81 >SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 846 Score = 29.1 bits (62), Expect = 0.62 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 515 HNTKYNQYLKMSTTTCNCNSRDRVVYGGNSA 607 HN +N + + S T+ + SR+ V+ GNS+ Sbjct: 617 HNEMFNSFHRSSVTSASIKSREAVLSAGNSS 647 >SPAC23H3.04 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 300 Score = 27.1 bits (57), Expect = 2.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -2 Query: 180 FQALTDSTVVVAGEDAVVQFLLEVLV 103 F +T V+V EDAVV+F+L +LV Sbjct: 181 FLGVTVQYVMVLPEDAVVEFVLTILV 206 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 27.1 bits (57), Expect = 2.5 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 103 NQDLEEKLYNSILTGDYDSAVRQSLE 180 + DLE+ + ++LTGD SAV+ LE Sbjct: 551 DSDLEKNITEALLTGDVLSAVKACLE 576 >SPAC56F8.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 394 Score = 26.6 bits (56), Expect = 3.3 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +2 Query: 575 RDRVVYGGNSADSTREQWFFQPAKYENDVLFFIYN 679 R R+V G ++A + + W F +Y ++F+++N Sbjct: 162 RQRIVVGKHAAHFSLDHWIF-VVEYYAPIVFYVFN 195 >SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 26.2 bits (55), Expect = 4.4 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 68 ARASLNYPRTLLTKTSRRNCTTASSPATTTVLSVRAW 178 AR SLNY ++ + SRRN ++P S + W Sbjct: 622 ARESLNYLKSFNKQLSRRNAPDINNPIADFQNSFQNW 658 >SPAC19E9.01c |nup40||nucleoporin Nup40|Schizosaccharomyces pombe|chr 1|||Manual Length = 371 Score = 25.4 bits (53), Expect = 7.6 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +2 Query: 29 NFSLYLRCACSPPARASLNYPRTLLTKTSRRNCTTASSPATTTVLSVRA 175 N S + C SP A A + P+TL T ASS T+ + V A Sbjct: 242 NDSFMVGCIYSP-AEAKEHVPKTLRNSNKDLEMTDASSSETSMSIPVHA 289 >SPBC1683.04 |||glycosyl hydrolase family 3|Schizosaccharomyces pombe|chr 2|||Manual Length = 832 Score = 25.4 bits (53), Expect = 7.6 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +1 Query: 403 PIPRMRELPTAMV*TSILNSSVGSSLPCGRTTECT*D 513 P R+ + P + TS NSS + PCG T D Sbjct: 39 PSIRLSDGPNGIRGTSFFNSSPSACFPCGTALGATFD 75 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,571,362 Number of Sequences: 5004 Number of extensions: 51236 Number of successful extensions: 162 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -