BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30367X (472 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 4.3 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 7.6 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 21 7.6 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 4.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 314 PNSDGFVCDTLAASGYFSCFVAFSQAYCDF 403 P +G VC T+ A +C F C+F Sbjct: 346 PCQNGGVCTTIHAGHKCTCPEGFYGKNCEF 375 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 20.6 bits (41), Expect = 7.6 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +3 Query: 51 IYHLMVMVMSLGGCLPHLSE 110 +YH+ M S GC ++E Sbjct: 342 LYHISFMACSSAGCSQKVAE 361 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 20.6 bits (41), Expect = 7.6 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -1 Query: 448 PNSAPGQSEIMAPRFEIAVGLRKGHKTTKISAG 350 PNS SE+ P+F++ +G R+ ++ G Sbjct: 203 PNSVGVSSEVSLPQFKV-LGHRRRAVEISLTTG 234 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,292 Number of Sequences: 336 Number of extensions: 1675 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10931752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -