BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30367X (472 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 2.2 U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. 22 2.9 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 2.9 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 2.9 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 2.9 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 2.9 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 2.9 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 2.9 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 2.9 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 2.9 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 2.9 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 2.9 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 2.9 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 2.9 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 2.9 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 2.9 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 2.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 2.9 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 2.9 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 2.9 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 2.9 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 2.9 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 2.9 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 2.9 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 2.9 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 2.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 2.9 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 2.9 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 2.9 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 2.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 2.9 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 2.9 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 2.9 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 2.9 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 3.8 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 6.7 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 8.8 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 8.8 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 2.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPLFEREEIKNVLTKINK 188 >U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. Length = 53 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 389 PAKRPQNN*NIRWPQGY 339 P + P N I+WPQGY Sbjct: 38 PGQGPFNP-KIKWPQGY 53 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 151 LIRRTGEGSKPIFEREEIKNVLTKINK 177 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVL 108 LKRR G + +REE+ N+L Sbjct: 159 LKRRTGEGSKPIFEREEIKNIL 180 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVL 108 LKRR G + +REE+ N+L Sbjct: 159 LKRRTGEGSKPIFEREEIKNIL 180 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 151 LIRRTGEGSKPIFEREEIKNVLTKINK 177 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVL 108 LKRR G + +REE+ N+L Sbjct: 159 LKRRTGEGSKPIFEREEIKNIL 180 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVL 108 LKRR G + +REE+ N+L Sbjct: 159 LKRRTGEGSKPIFEREEIKNIL 180 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVL 108 LKRR G + +REE+ N+L Sbjct: 159 LKRRTGEGSKPIFEREEIKNIL 180 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVL 108 LKRR G + +REE+ N+L Sbjct: 159 LKRRTGEGSKPIFEREEIKNIL 180 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 151 LIRRTGEGSKPIFEREEIKNVLTKINK 177 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 167 RRLGTHIRAKRKREELSNVLAQMRK 93 RR G + +REE+ NVL ++ K Sbjct: 153 RRTGEGSKPLFEREEIKNVLTKINK 177 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVL 108 LKRR G + +REE+ N+L Sbjct: 159 LKRRTGEGSKPIFEREEIKNIL 180 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 167 RRLGTHIRAKRKREELSNVLAQMRK 93 RR G + +REE+ NVL ++ K Sbjct: 164 RRTGEGSKPLFEREEIKNVLTKINK 188 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 167 RRLGTHIRAKRKREELSNVLAQMRK 93 RR G + +REE+ NVL ++ K Sbjct: 164 RRTGEGSKPLFEREEIKNVLTKINK 188 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 167 RRLGTHIRAKRKREELSNVLAQMRK 93 RR G + +REE+ NVL ++ K Sbjct: 153 RRTGEGSKPLFEREEIKNVLTKINK 177 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 151 LIRRTGEGSKPIFEREEIKNVLTKINK 177 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 167 LIRRTGEGSKPIFEREEIKNVLTKINK 193 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVL 108 LKRR G + +REE+ N+L Sbjct: 159 LKRRTGEGSKPIFEREEIKNIL 180 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 173 LKRRLGTHIRAKRKREELSNVLAQMRK 93 L RR G + +REE+ NVL ++ K Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 3.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 167 RRLGTHIRAKRKREELSNVLAQMRK 93 RR G + +REE+ NVL ++ K Sbjct: 164 RRTGEGSKPIFEREEIKNVLTKINK 188 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.0 bits (42), Expect = 6.7 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 395 CDFKTRSHDFGLTWCR 442 C ++S D+G T CR Sbjct: 282 CPAHSKSSDYGFTECR 297 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 20.6 bits (41), Expect = 8.8 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = -1 Query: 307 RLKGLQTKHSKFVRDLVRKLSDTLNMRRGLWSYL 206 RL QT H DL +L + L WS L Sbjct: 63 RLTYGQTNHISLTLDLEYELVENLQANEKPWSTL 96 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 20.6 bits (41), Expect = 8.8 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = -1 Query: 307 RLKGLQTKHSKFVRDLVRKLSDTLNMRRGLWSYL 206 RL QT H DL +L + L WS L Sbjct: 101 RLTYGQTNHISLTLDLEYELVENLQANEKPWSTL 134 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,308 Number of Sequences: 438 Number of extensions: 1984 Number of successful extensions: 38 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12682287 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -