BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30367X (472 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02450.1 68418.m00171 60S ribosomal protein L36 (RPL36C) 60S ... 80 9e-16 At3g53740.2 68416.m05937 60S ribosomal protein L36 (RPL36B) 60S ... 80 9e-16 At2g37600.1 68415.m04613 60S ribosomal protein L36 (RPL36A) 79 1e-15 At3g53740.1 68416.m05936 60S ribosomal protein L36 (RPL36B) 60S ... 56 9e-09 At1g34590.1 68414.m04299 hypothetical protein 28 2.8 >At5g02450.1 68418.m00171 60S ribosomal protein L36 (RPL36C) 60S ribosomal protein L36, Arabidopsis thaliana, EMBL:AC004684 Length = 108 Score = 79.8 bits (188), Expect = 9e-16 Identities = 39/53 (73%), Positives = 43/53 (81%) Frame = -3 Query: 254 EVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMR 96 EV G A YEKR ELLKV KDKRALK KR+LGTH RAKRKREE+S+VL +MR Sbjct: 45 EVAGQAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMR 97 >At3g53740.2 68416.m05937 60S ribosomal protein L36 (RPL36B) 60S RIBOSOMAL PROTEIN L36 - Schizosaccharomyces pombe, swissprot:Q92365 Length = 112 Score = 79.8 bits (188), Expect = 9e-16 Identities = 39/53 (73%), Positives = 43/53 (81%) Frame = -3 Query: 254 EVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMR 96 EV G A YEKR ELLKV KDKRALK KR+LGTH RAKRKREE+S+VL +MR Sbjct: 49 EVAGQAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMR 101 >At2g37600.1 68415.m04613 60S ribosomal protein L36 (RPL36A) Length = 113 Score = 79.0 bits (186), Expect = 1e-15 Identities = 39/53 (73%), Positives = 43/53 (81%) Frame = -3 Query: 254 EVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMR 96 EV G A YEKR ELLKV KDKRALK KR+LGTH RAKRKREE+S+VL +MR Sbjct: 49 EVAGMAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMR 101 Score = 26.6 bits (56), Expect = 8.5 Identities = 18/67 (26%), Positives = 31/67 (46%) Frame = -1 Query: 394 VGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVRKLSDTLNMRRGLW 215 VGL KGH T+ + + RP KG +K + F+R L+R+++ + + Sbjct: 12 VGLNKGHVVTR----------RELAPRPNSRKGKTSKRTIFIRKLIREVAGMAPYEKRIT 61 Query: 214 SYLRCQK 194 L+ K Sbjct: 62 ELLKVGK 68 >At3g53740.1 68416.m05936 60S ribosomal protein L36 (RPL36B) 60S RIBOSOMAL PROTEIN L36 - Schizosaccharomyces pombe, swissprot:Q92365 Length = 103 Score = 56.4 bits (130), Expect = 9e-09 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = -3 Query: 254 EVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMR 96 EV G A YEKR ELLKV+K R+LGTH RAKRKREE+S+VL +MR Sbjct: 49 EVAGQAPYEKRITELLKVAK---------RKLGTHKRAKRKREEMSSVLRKMR 92 >At1g34590.1 68414.m04299 hypothetical protein Length = 820 Score = 28.3 bits (60), Expect = 2.8 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = -1 Query: 430 QSEIMAPRFEIAVGLRKGHKTTKISAGRKGITDKAIRIRPAR 305 + ++ AP E A GH++ + A + G+TD+A + PA+ Sbjct: 770 KDDLKAPALESAPLSPGGHRSVESVADKAGVTDQAGSLLPAK 811 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,755,478 Number of Sequences: 28952 Number of extensions: 163851 Number of successful extensions: 423 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 801831960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -