BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30366 (625 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24372| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.5e-40) 46 2e-05 SB_14467| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 31 0.76 SB_24053| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_37330| Best HMM Match : S-antigen (HMM E-Value=4.1e-09) 30 1.3 SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_46754| Best HMM Match : zf-C2H2 (HMM E-Value=1.5e-29) 29 2.3 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_25108| Best HMM Match : Cornifin (HMM E-Value=0.00015) 29 3.1 SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) 29 4.1 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 28 7.1 SB_37763| Best HMM Match : rve (HMM E-Value=4.2e-27) 27 9.4 SB_30628| Best HMM Match : Alpha-2-MRAP_N (HMM E-Value=1.2) 27 9.4 SB_42838| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-39) 27 9.4 SB_40530| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_24372| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.5e-40) Length = 154 Score = 46.4 bits (105), Expect = 2e-05 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = +2 Query: 26 MRIETCYFCSSRVYPGHGIQFVRNDCKIFRFCRSKCHAA 142 M++E C + ++YPGHG ++VR D K+F F +C A Sbjct: 1 MKLELCNYSGYKIYPGHGKRYVRQDGKVFNFLNKRCERA 39 >SB_14467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 352 Score = 41.5 bits (93), Expect = 5e-04 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = +2 Query: 185 AYRKTAGKELSIDPSFEFEKRRNGP 259 A+RK AGK+L+ID +FEFEK+RN P Sbjct: 13 AFRKAAGKDLAIDSTFEFEKKRNVP 37 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +1 Query: 241 KETKWPLKYNRELWTKTIEAMK 306 K+ P+KYNRELW+ T E++K Sbjct: 32 KKRNVPVKYNRELWSNT-ESLK 52 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 31.1 bits (67), Expect = 0.76 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 4/68 (5%) Frame = -3 Query: 590 HHPS--SINSPVAGTMT--GASIICFLPFSVPTSMVSGSTSISVASKACRCFRPAAGDFI 423 HHP+ S++ P + G S +C LPF+ P S SGS + S P+A + + Sbjct: 264 HHPNTQSVDEPNQASCLSFGGSPLCNLPFTTPYSFPSGSKKRNSKSP-----HPSAPNRL 318 Query: 422 KEMSLWTS 399 + S W+S Sbjct: 319 ADPSQWSS 326 >SB_24053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2557 Score = 31.1 bits (67), Expect = 0.76 Identities = 27/116 (23%), Positives = 53/116 (45%), Gaps = 3/116 (2%) Frame = +1 Query: 244 ETKWPLKYNRELWTKTIEAMKKVEEIRQRRSNNYIMQRLRQGREVEWQRDV---REVQRD 414 ET+W RE + ++ + + +R+ + + L +GR+ E + +R Sbjct: 1778 ETQWAALSERERQARLVKLKLQEKRLREDGKLDEASRLLGEGRKHEAGLRALIGQSKERQ 1837 Query: 415 ISLIKSPAAGLKQRQALEATEMEVEPETIEVGTLKGRKQIIEAPVMVPATGELIEE 582 L+K L+QR+A + E ET+E+ G + +++ V+ TGE + E Sbjct: 1838 QQLLKERLEKLRQRKASGEVVNDDELETLEMIEANGIES-VDSVVLDRITGETVAE 1892 >SB_37330| Best HMM Match : S-antigen (HMM E-Value=4.1e-09) Length = 818 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Frame = +3 Query: 348 YAAIETGQRGRVAKR---RARSPERHLFDKVTSGWSETATSFRSHRNGSRTRDHRSWDAK 518 Y A++ ++ + + R R+RSP R WS + + SH + SR+ WD Sbjct: 323 YRALQRSRQHKPSSRNTSRSRSPVRSRSPIHPRSWSRSVSHSLSHSSASRSPTPEDWDRS 382 Query: 519 R 521 R Sbjct: 383 R 383 >SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1906 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +1 Query: 298 AMKKVEEIRQRRSNNYIMQRLRQGREVEWQRDVREVQRDISLIKSPAAGLKQRQ 459 AMKK++E R+ +++ + E +++RE +RD +K+ L Q + Sbjct: 1386 AMKKLQEARESEGKELVLRTEEIEKLYERNKELREKERDYEELKTKMRDLSQTE 1439 >SB_46754| Best HMM Match : zf-C2H2 (HMM E-Value=1.5e-29) Length = 487 Score = 29.5 bits (63), Expect = 2.3 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 8/92 (8%) Frame = +1 Query: 295 EAMKKVEEIRQRRSNNYIMQ---RLRQGREVEWQRDVREVQRDISLIKSPA-AGLKQRQA 462 E KK EE R+RR + + R R+ + QRD ++R + K K Sbjct: 193 ELRKKREEARKRREEKLAEKESSKSRNKRKSKEQRDEPSLKRSTATPKKTRKTAAKDSSE 252 Query: 463 LE----ATEMEVEPETIEVGTLKGRKQIIEAP 546 +E A E EP + + KGRK + +AP Sbjct: 253 VERIRGAGESSSEPSSKRSQSTKGRKNVNKAP 284 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 29.1 bits (62), Expect = 3.1 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +3 Query: 369 QRGRVAKRRARSPERHLFDKVTSGWSETATSFRSHRNGSRTRDHRSWDAKRQETD 533 ++GR ++ R + E + D T S + RSHR+GSR R D + D Sbjct: 5244 KKGRSSRHRHHNSEG-IGDDDTDNTSSSTAPTRSHRHGSRGRHRNEEDIGDDDAD 5297 >SB_25108| Best HMM Match : Cornifin (HMM E-Value=0.00015) Length = 858 Score = 29.1 bits (62), Expect = 3.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 150 FLNAAWHFERQNLKILQSFRTNWI 79 +L + WHFER NL ++ ++WI Sbjct: 511 YLRSIWHFERLNLWLILILGSSWI 534 >SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) Length = 843 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +2 Query: 41 CYFCSSRVYPGHGIQFVRNDCKIFRF--CRSKCHA 139 C FC+S+VYP +F +C ++ C + H+ Sbjct: 410 CNFCASKVYPPKPARFFCTECAVYSCGNCSDEIHS 444 >SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) Length = 709 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = +3 Query: 12 LKPIKCV*KHVISVHPGFILDTESNLSGMTAKFSDSVVQNATQRLKRRRIPVKLNGLKLT 191 ++P+K +H+ H F+ + L G+T KF D + + +R IP L+ + Sbjct: 264 VRPLK---EHISCAHKCFVFQILAKLRGITRKFVDYAEKAKLRASAQRVIPEALSAVSKA 320 Query: 192 V 194 V Sbjct: 321 V 321 >SB_37763| Best HMM Match : rve (HMM E-Value=4.2e-27) Length = 510 Score = 27.5 bits (58), Expect = 9.4 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +3 Query: 93 GMTAKFSDSVVQNATQRLKRRRIPVKLNGLKL--TVRLRVRNCL*THPLSLKR 245 G A+ + ++N L R+RI LNG+K+ +RL +N P+ KR Sbjct: 139 GEGARKLNPTIRNIYAGLSRKRIEETLNGMKVPNEIRLLFQNKAPLRPIKAKR 191 >SB_30628| Best HMM Match : Alpha-2-MRAP_N (HMM E-Value=1.2) Length = 172 Score = 27.5 bits (58), Expect = 9.4 Identities = 19/69 (27%), Positives = 39/69 (56%) Frame = +1 Query: 280 WTKTIEAMKKVEEIRQRRSNNYIMQRLRQGREVEWQRDVREVQRDISLIKSPAAGLKQRQ 459 W K+ ++K +E + R+ +QR RE+E+ R +E++R +I+ +K+R+ Sbjct: 97 WLKS--SVKLLESALRERNKQMDIQR----REIEFLR--KELRRKDEVIREYENIIKERE 148 Query: 460 ALEATEMEV 486 +E E+E+ Sbjct: 149 DMEKRELEI 157 >SB_42838| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-39) Length = 747 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 623 LASFTLTTIQYHHPSSINSPVAGTMTGASIICFLPFSV 510 + S T+ TIQ + + ++TG ICF PF++ Sbjct: 512 ICSETVETIQGREEKKKLAKLLASVTGVYFICFAPFAI 549 >SB_40530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 81 SNLSGMTAKFSDSVVQNATQRLKRRRIPVKLNGLKLTVRLRVRNC 215 S++ K +V+QN T RL PV +G+K RL V++C Sbjct: 854 SSIGTAGIKAITNVIQNVT-RLNLSSNPVGYDGVKAIARLLVKSC 897 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,015,762 Number of Sequences: 59808 Number of extensions: 365756 Number of successful extensions: 1130 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1130 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -