BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30366 (625 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g44860.1 68415.m05585 60S ribosomal protein L24, putative 105 3e-23 At3g53020.1 68416.m05844 60S ribosomal protein L24 (RPL24B) 60S ... 50 2e-06 At2g36620.1 68415.m04490 60S ribosomal protein L24 (RPL24A) 50 2e-06 At5g20490.1 68418.m02435 myosin, putative similar to myosin (GI:... 30 1.4 At1g76870.1 68414.m08945 hypothetical protein 30 1.4 At1g28570.1 68414.m03517 GDSL-motif lipase, putative similar to ... 30 1.4 At2g42210.1 68415.m05224 mitochondrial import inner membrane tra... 28 4.4 At5g38590.2 68418.m04666 F-box family protein contains F-box dom... 28 5.8 At5g38590.1 68418.m04667 F-box family protein contains F-box dom... 28 5.8 At1g12170.1 68414.m01409 F-box family protein contains F-box dom... 28 5.8 At3g18480.1 68416.m02348 CCAAT displacement protein-related / CD... 27 7.7 >At2g44860.1 68415.m05585 60S ribosomal protein L24, putative Length = 159 Score = 105 bits (251), Expect = 3e-23 Identities = 45/78 (57%), Positives = 54/78 (69%) Frame = +2 Query: 26 MRIETCYFCSSRVYPGHGIQFVRNDCKIFRFCRSKCHAAFXXXXXXXXXXXXXAYRKTAG 205 MR+E C+FCSS +YPGHGIQFVRND KIFRFCRSKCH F A+R G Sbjct: 1 MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAFRAAHG 60 Query: 206 KELSIDPSFEFEKRRNGP 259 K+++ D +FEFEK+RN P Sbjct: 61 KDMTKDTTFEFEKKRNRP 78 Score = 46.0 bits (104), Expect = 2e-05 Identities = 24/89 (26%), Positives = 53/89 (59%), Gaps = 1/89 (1%) Frame = +1 Query: 241 KETKWPLKYNRELWTKTIEAMKKVEEIRQRRSNNYIMQRLRQGREVEWQRDVREVQRDIS 420 K+ P +Y+R + T+ A+KK+ +IR R +I RL+ ++ + D++E+ ++I Sbjct: 73 KKRNRPERYDRNVTENTLMAIKKIAKIRTAREAKHIENRLKPNKQKKLNDDMKELDQNIH 132 Query: 421 LIKSPAAGLKQRQALEATEME-VEPETIE 504 ++++P A Q+ ++ +E + V+ E +E Sbjct: 133 MVQAPGA---QKIKVDVSEKKSVQNEAME 158 >At3g53020.1 68416.m05844 60S ribosomal protein L24 (RPL24B) 60S ribosomal protein L24, Arabidopsis thaliana, EMBL:AC006282 Length = 163 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/62 (33%), Positives = 31/62 (50%) Frame = +2 Query: 26 MRIETCYFCSSRVYPGHGIQFVRNDCKIFRFCRSKCHAAFXXXXXXXXXXXXXAYRKTAG 205 ++ E C F ++YPG GI+F+R+D ++F F SKC F YRK Sbjct: 3 LKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLAWTAMYRKQHK 62 Query: 206 KE 211 K+ Sbjct: 63 KD 64 >At2g36620.1 68415.m04490 60S ribosomal protein L24 (RPL24A) Length = 164 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/62 (33%), Positives = 31/62 (50%) Frame = +2 Query: 26 MRIETCYFCSSRVYPGHGIQFVRNDCKIFRFCRSKCHAAFXXXXXXXXXXXXXAYRKTAG 205 ++ E C F ++YPG GI+F+R+D ++F F SKC F YRK Sbjct: 3 LKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLCWTAMYRKQHK 62 Query: 206 KE 211 K+ Sbjct: 63 KD 64 >At5g20490.1 68418.m02435 myosin, putative similar to myosin (GI:433663) [Arabidopsis thaliana]; myosin-like protein my5, common sunflower, PIR:T14279 Length = 1545 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 2/72 (2%) Frame = +1 Query: 373 EVEWQRDVREVQRDISLIKSPAAGLKQRQALEATEMEVEPETIEVGTLK--GRKQIIEAP 546 E+ W+ + + QR KQ++ALE ++VE V + RK I EAP Sbjct: 914 ELTWRLQLEKRQRTELEEAKTQEYAKQQEALETMRLQVEEANAAVIREREAARKAIEEAP 973 Query: 547 VMVPATGELIEE 582 ++ T L+E+ Sbjct: 974 PVIKETPVLVED 985 >At1g76870.1 68414.m08945 hypothetical protein Length = 385 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +1 Query: 388 RDVREVQRDISLIKSPAAGLKQRQALEATEMEVEPETIEV 507 R +V R ISL AAGL QRQ +E+ +E+E +++ Sbjct: 292 RSQADVNRGISLDSRKAAGL-QRQQIESKSLELEGRKLQI 330 >At1g28570.1 68414.m03517 GDSL-motif lipase, putative similar to lipase [Arabidopsis thaliana] GI:1145627; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 384 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = -2 Query: 429 LYQRDVSLDFSHVSLPLYLSALSQSLHNIIITPS 328 L +R + +++VSL + LS+ +SL N+ ++PS Sbjct: 121 LEERGIHFPYTNVSLAVQLSSFKESLPNLCVSPS 154 >At2g42210.1 68415.m05224 mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein weak similarity to SP|P25710 NADH-ubiquinone oxidoreductase 21.3 kDa subunit (EC 1.6.5.3) (EC 1.6.99.3) {Neurospora crassa}, SP|Q12328 Mitochondrial import inner membrane translocase subunit TIM22 {Saccharomyces cerevisiae}; contains Pfam profile PF02466: Mitochondrial import inner membrane translocase subunit Tim17 Length = 159 Score = 28.3 bits (60), Expect = 4.4 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -3 Query: 572 NSPVAGTMTGASIICFLPFSVPTSMVSGST 483 N + G + GAS++ + S+PT++ +G+T Sbjct: 94 NGAIGGFVAGASVLGYRARSIPTAIAAGAT 123 >At5g38590.2 68418.m04666 F-box family protein contains F-box domain Pfam:PF00646 Length = 410 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 456 SLFQTSRW*LYQRDVSL-DFSHVSLPLYLSALSQSL 352 +L TSRW DV L DF H +LPL+ + + +SL Sbjct: 43 NLDYTSRWCRKPGDVGLRDFIHKNLPLHRAPVIESL 78 >At5g38590.1 68418.m04667 F-box family protein contains F-box domain Pfam:PF00646 Length = 289 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 456 SLFQTSRW*LYQRDVSL-DFSHVSLPLYLSALSQSL 352 +L TSRW DV L DF H +LPL+ + + +SL Sbjct: 43 NLDYTSRWCRKPGDVGLRDFIHKNLPLHRAPVIESL 78 >At1g12170.1 68414.m01409 F-box family protein contains F-box domain Pfam:PF00646 Length = 364 Score = 27.9 bits (59), Expect = 5.8 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = +3 Query: 3 HTCLKPIKCV*KHVISVHPGFILDTESNLSGMTAKFSDSVVQNATQRLKRRRIPVKLNGL 182 +T K V H++ V P F+L T+S + +S SV N Q++ R +P+ + L Sbjct: 34 NTLFKSKSFVNNHLVRVRPQFLLWTDSKM------YSVSVNLNDDQKIDMRELPLDIPYL 87 Query: 183 KLTVRLRVRNC 215 +R C Sbjct: 88 NNFMRTYFTPC 98 >At3g18480.1 68416.m02348 CCAAT displacement protein-related / CDP-related similar to CCAAT displacement protein (CDP) (Cut-like 1) (Swiss-Prot:P39880) [Homo sapiens]; contains Pfam:PF00904 Involucrin repeat Length = 689 Score = 27.5 bits (58), Expect = 7.7 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Frame = +1 Query: 268 NRELWTKTIEAMKKVEEIRQRR--SNNYIMQRLRQGREVEWQRDVREVQRDISLIKSPAA 441 NR+L + E +K+V EI+QR N L + RE Q +R+ + +S ++ Sbjct: 175 NRQLEQQMEEKIKEVVEIKQRNLAEENQKTMELLKDREQALQDQLRQAKDSVSTMQK-LH 233 Query: 442 GLKQRQALE 468 L Q Q E Sbjct: 234 ELAQNQLFE 242 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,476,472 Number of Sequences: 28952 Number of extensions: 265423 Number of successful extensions: 787 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 767 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 787 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -