BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30364 (478 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2QH12 Cluster: Similarity to carboxypeptidase S1 -Peni... 35 1.1 UniRef50_A0L8L7 Cluster: TPR repeat-containing protein; n=1; Mag... 31 10.0 >UniRef50_A2QH12 Cluster: Similarity to carboxypeptidase S1 -Penicillium janthinellum precursor; n=5; Dikarya|Rep: Similarity to carboxypeptidase S1 -Penicillium janthinellum precursor - Aspergillus niger Length = 566 Score = 34.7 bits (76), Expect = 1.1 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 306 RYNSINTLRCKDGASSRSFNGVVSQPRHEYYFFW 205 RY + T C+ S +SF+G V HE+ FFW Sbjct: 40 RYKQVPTGICETDPSVKSFSGYVDVAEHEHIFFW 73 >UniRef50_A0L8L7 Cluster: TPR repeat-containing protein; n=1; Magnetococcus sp. MC-1|Rep: TPR repeat-containing protein - Magnetococcus sp. (strain MC-1) Length = 822 Score = 31.5 bits (68), Expect = 10.0 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -3 Query: 128 MLNLKYAITKVN*TKYINETGGGCRDGLVIAVRTVPRAL 12 M LK A +++ Y+N +G GC DG+++ T P L Sbjct: 556 MFALKPAPVQLSWAGYVNSSGLGCMDGVILDCYTAPAGL 594 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 363,705,957 Number of Sequences: 1657284 Number of extensions: 5523112 Number of successful extensions: 9959 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9958 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 26870548160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -