BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30363 (471 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9NPE3 Cluster: H/ACA ribonucleoprotein complex subunit... 85 1e-15 UniRef50_Q9V5P6 Cluster: H/ACA ribonucleoprotein complex subunit... 75 6e-13 UniRef50_Q93XX8 Cluster: H/ACA ribonucleoprotein complex subunit... 69 7e-11 UniRef50_Q019V2 Cluster: H/ACA snoRNP complex, subunit NOP10; n=... 55 7e-07 UniRef50_Q2FPD6 Cluster: Nucleolar RNA-binding protein Nop10p; n... 46 6e-04 UniRef50_A6UUW5 Cluster: Nucleolar RNA-binding protein Nop10p; n... 44 0.002 UniRef50_Q97Z78 Cluster: Ribosome biogenesis protein Nop10; n=2;... 42 0.009 UniRef50_A2EP66 Cluster: Nucleolar RNA-binding protein, putative... 40 0.036 UniRef50_UPI0000498FA1 Cluster: conserved hypothetical protein; ... 38 0.084 UniRef50_Q8U1R4 Cluster: Ribosome biogenesis protein Nop10; n=7;... 36 0.34 UniRef50_A0B683 Cluster: Nucleolar RNA-binding protein Nop10p; n... 36 0.59 UniRef50_Q8TT00 Cluster: Ribosome biogenesis protein Nop10; n=7;... 36 0.59 UniRef50_A0Q1X6 Cluster: Putative uncharacterized protein; n=1; ... 35 1.0 UniRef50_Q8ZTY6 Cluster: Ribosome biogenesis protein Nop10; n=4;... 33 2.4 UniRef50_Q86AK1 Cluster: Similar to Delayed Anaerobic Gene; Dan4... 31 9.7 UniRef50_Q23RK0 Cluster: Putative uncharacterized protein; n=1; ... 31 9.7 UniRef50_P81303 Cluster: Ribosome biogenesis protein Nop10; n=3;... 31 9.7 >UniRef50_Q9NPE3 Cluster: H/ACA ribonucleoprotein complex subunit 3; n=25; Eukaryota|Rep: H/ACA ribonucleoprotein complex subunit 3 - Homo sapiens (Human) Length = 64 Score = 84.6 bits (200), Expect = 1e-15 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = +1 Query: 103 MYLRYYLNDKGDREYTLATIDPFGKPTLSAHPARFSPEDKYSRHRIIIKK 252 M+L+YYLN++GDR YTL DP G+ T SAHPARFSP+DKYSRHRI IKK Sbjct: 1 MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK 50 >UniRef50_Q9V5P6 Cluster: H/ACA ribonucleoprotein complex subunit 3; n=13; Eukaryota|Rep: H/ACA ribonucleoprotein complex subunit 3 - Drosophila melanogaster (Fruit fly) Length = 64 Score = 75.4 bits (177), Expect = 6e-13 Identities = 35/56 (62%), Positives = 39/56 (69%) Frame = +1 Query: 103 MYLRYYLNDKGDREYTLATIDPFGKPTLSAHPARFSPEDKYSRHRIIIKKSLACCL 270 MYL Y +N+ GDR YTL G+PTLSAHPARFSPEDKYSR R+ IKK L Sbjct: 1 MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLLL 56 >UniRef50_Q93XX8 Cluster: H/ACA ribonucleoprotein complex subunit 3-like protein; n=35; Eukaryota|Rep: H/ACA ribonucleoprotein complex subunit 3-like protein - Arabidopsis thaliana (Mouse-ear cress) Length = 64 Score = 68.5 bits (160), Expect = 7e-11 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = +1 Query: 103 MYLRYYLNDKGDREYTLATIDPFGKPTLSAHPARFSPEDKYSRHRIIIKK 252 MYL+ Y+N+KG++ YT P G T SAHPARFSP+DKYS+ R+++KK Sbjct: 1 MYLQCYINEKGEKVYTTKKESPLGLATESAHPARFSPDDKYSKQRVLLKK 50 >UniRef50_Q019V2 Cluster: H/ACA snoRNP complex, subunit NOP10; n=2; Eukaryota|Rep: H/ACA snoRNP complex, subunit NOP10 - Ostreococcus tauri Length = 91 Score = 55.2 bits (127), Expect = 7e-07 Identities = 29/62 (46%), Positives = 37/62 (59%), Gaps = 13/62 (20%) Frame = +1 Query: 106 YLRYYLNDKGDREYTLATID-------------PFGKPTLSAHPARFSPEDKYSRHRIII 246 YL YY ++KG+R YTL P G PT SAHPARFSP+DK+S+ R+ + Sbjct: 16 YLMYYTDEKGERVYTLKVRSAKRRKPRAGDKTAPDGTPTHSAHPARFSPDDKFSKQRVAL 75 Query: 247 KK 252 KK Sbjct: 76 KK 77 >UniRef50_Q2FPD6 Cluster: Nucleolar RNA-binding protein Nop10p; n=1; Methanospirillum hungatei JF-1|Rep: Nucleolar RNA-binding protein Nop10p - Methanospirillum hungatei (strain JF-1 / DSM 864) Length = 49 Score = 45.6 bits (103), Expect = 6e-04 Identities = 19/39 (48%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = +1 Query: 136 DREYTLA-TIDPFGKPTLSAHPARFSPEDKYSRHRIIIK 249 D YTL+ T GKPT++ HPAR+SP+D+Y ++R +I+ Sbjct: 11 DNLYTLSETCSSCGKPTITPHPARYSPDDRYGKYRRMIR 49 >UniRef50_A6UUW5 Cluster: Nucleolar RNA-binding protein Nop10p; n=1; Methanococcus aeolicus Nankai-3|Rep: Nucleolar RNA-binding protein Nop10p - Methanococcus aeolicus Nankai-3 Length = 51 Score = 44.0 bits (99), Expect = 0.002 Identities = 18/40 (45%), Positives = 28/40 (70%) Frame = +1 Query: 139 REYTLATIDPFGKPTLSAHPARFSPEDKYSRHRIIIKKSL 258 + YTL TI G+ T++ P R+SP DKY ++R ++KKS+ Sbjct: 10 KNYTLNTICQCGEKTITVKPPRYSPTDKYGKYRRMLKKSI 49 >UniRef50_Q97Z78 Cluster: Ribosome biogenesis protein Nop10; n=2; Sulfolobus|Rep: Ribosome biogenesis protein Nop10 - Sulfolobus solfataricus Length = 56 Score = 41.5 bits (93), Expect = 0.009 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +1 Query: 136 DREYTLA-TIDPFGKPTLSAHPARFSPEDKYSRHRIIIKKSL 258 D YT T G T+ HP+RFSPEDKY ++RI +KK + Sbjct: 11 DNIYTFKDTCQICGSKTVIPHPSRFSPEDKYVKYRIELKKGI 52 >UniRef50_A2EP66 Cluster: Nucleolar RNA-binding protein, putative; n=2; Trichomonas vaginalis G3|Rep: Nucleolar RNA-binding protein, putative - Trichomonas vaginalis G3 Length = 83 Score = 39.5 bits (88), Expect = 0.036 Identities = 22/38 (57%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +1 Query: 139 REYTLATIDP-FGKPTLSAHPARFSPEDKYSRHRIIIK 249 ++YTL P G T SAHPARFSPEDK S RI K Sbjct: 31 KQYTLKQKCPRCGGQTRSAHPARFSPEDKNSAERIQTK 68 >UniRef50_UPI0000498FA1 Cluster: conserved hypothetical protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: conserved hypothetical protein - Entamoeba histolytica HM-1:IMSS Length = 59 Score = 38.3 bits (85), Expect = 0.084 Identities = 22/49 (44%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = +1 Query: 109 LRYYLNDKGDREYTLATIDPFGKPTL-SAHPARFSPEDKYSRHRIIIKK 252 L YY ++ ++YT+ T P + SAHPA+FSP D YS++RI KK Sbjct: 2 LLYYCDNC--KQYTMKTECPQCNGYVRSAHPAKFSPVDPYSKYRIATKK 48 >UniRef50_Q8U1R4 Cluster: Ribosome biogenesis protein Nop10; n=7; Archaea|Rep: Ribosome biogenesis protein Nop10 - Pyrococcus furiosus Length = 60 Score = 36.3 bits (80), Expect = 0.34 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 145 YTLATIDPF-GKPTLSAHPARFSPEDKYSRHR 237 YTL + P G+ T AHP RFSPED Y +R Sbjct: 14 YTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYR 45 >UniRef50_A0B683 Cluster: Nucleolar RNA-binding protein Nop10p; n=1; Methanosaeta thermophila PT|Rep: Nucleolar RNA-binding protein Nop10p - Methanosaeta thermophila (strain DSM 6194 / PT) (Methanothrixthermophila (strain DSM 6194 / PT)) Length = 60 Score = 35.5 bits (78), Expect = 0.59 Identities = 18/34 (52%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 139 REYTLATIDP-FGKPTLSAHPARFSPEDKYSRHR 237 R YTL P G T PARFSPED+Y R+R Sbjct: 13 RLYTLKETCPRCGSHTTGTKPARFSPEDRYGRYR 46 >UniRef50_Q8TT00 Cluster: Ribosome biogenesis protein Nop10; n=7; Euryarchaeota|Rep: Ribosome biogenesis protein Nop10 - Methanosarcina acetivorans Length = 51 Score = 35.5 bits (78), Expect = 0.59 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +1 Query: 145 YTLATIDPF-GKPTLSAHPARFSPEDKYSRHRIIIKK 252 YTL P G TL A PARFSP+D Y ++R + KK Sbjct: 14 YTLREKCPVCGGVTLPAIPARFSPQDPYGKYRRLAKK 50 >UniRef50_A0Q1X6 Cluster: Putative uncharacterized protein; n=1; Clostridium novyi NT|Rep: Putative uncharacterized protein - Clostridium novyi (strain NT) Length = 161 Score = 34.7 bits (76), Expect = 1.0 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -2 Query: 425 FVRAFVFCCMLYKSCVP*ILKIIVKMYQNLDHFGNFQ 315 ++ AF+ + KSC P I ++IV++ NLD + NF+ Sbjct: 86 YMEAFMNYSLNIKSCYPNIYRVIVRLLMNLDKYENFE 122 >UniRef50_Q8ZTY6 Cluster: Ribosome biogenesis protein Nop10; n=4; Archaea|Rep: Ribosome biogenesis protein Nop10 - Pyrobaculum aerophilum Length = 72 Score = 33.5 bits (73), Expect = 2.4 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 193 HPARFSPEDKYSRHRIIIK 249 HP +FSPEDKY ++RI+ K Sbjct: 32 HPPKFSPEDKYQKYRILQK 50 >UniRef50_Q86AK1 Cluster: Similar to Delayed Anaerobic Gene; Dan4p; n=2; Dictyostelium discoideum|Rep: Similar to Delayed Anaerobic Gene; Dan4p - Dictyostelium discoideum (Slime mold) Length = 457 Score = 31.5 bits (68), Expect = 9.7 Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = -2 Query: 257 KLFLIIILCLEYLS-SGEKRAGCADNVGFPN 168 K+ +++I+C+ YLS S K G +DN G+PN Sbjct: 2 KISILLIICIIYLSISNVKSYGESDNSGYPN 32 >UniRef50_Q23RK0 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 691 Score = 31.5 bits (68), Expect = 9.7 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 174 KTNIVSTSSSFFS*RQILKTQNNNQEEFGLLLTQ 275 K N+ +TS S Q +QNN+Q+ FG+++ Q Sbjct: 551 KDNLSNTSKSSLKDEQFAASQNNSQKSFGIIVNQ 584 >UniRef50_P81303 Cluster: Ribosome biogenesis protein Nop10; n=3; Archaea|Rep: Ribosome biogenesis protein Nop10 - Methanococcus jannaschii Length = 60 Score = 31.5 bits (68), Expect = 9.7 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +1 Query: 145 YTLATIDP-FGKPTLSAHPARFSPEDKYSRHRIIIKKSL 258 YTL I P G+ T+ P +FS ED++ ++R ++K++L Sbjct: 15 YTLKEICPKCGEKTVIPKPPKFSLEDRWGKYRRMLKRAL 53 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 424,383,607 Number of Sequences: 1657284 Number of extensions: 7892379 Number of successful extensions: 16119 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 15687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16108 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 26030843530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -