BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30363 (471 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0766 - 5885207-5885791,5885874-5886224,5886252-5886269,588... 27 5.8 03_06_0389 - 33567385-33567969,33568052-33568402,33568646-335688... 27 7.6 01_05_0451 - 22361617-22361811,22362728-22362842,22363443-223635... 27 7.6 >07_01_0766 - 5885207-5885791,5885874-5886224,5886252-5886269, 5886339-5886541,5886632-5886890,5887052-5887264, 5887357-5887482,5887590-5887727,5887817-5888162, 5888254-5888520,5888983-5889172,5889264-5889363, 5889444-5889694,5889990-5890182,5890313-5890336 Length = 1087 Score = 27.5 bits (58), Expect = 5.8 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 456 FASHNKVIYPFCKSICVLLY-VI*ILCALDFENNC*NVSKFRPFW*FSMQINIY 298 FA N IYP SI +L+Y V+ +C L + +S F W S+ I+I+ Sbjct: 858 FAYINTTIYPL-TSIPLLIYCVLPAICLLTGKFIIPEISNFASIWFISLFISIF 910 >03_06_0389 - 33567385-33567969,33568052-33568402,33568646-33568848, 33569044-33569299,33569459-33569671,33569757-33569882, 33569965-33570102,33570191-33570536,33570630-33570896, 33571192-33571378,33571457-33571556,33571659-33571909, 33572242-33572428,33572562-33572573 Length = 1073 Score = 27.1 bits (57), Expect = 7.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 456 FASHNKVIYPFCKSICVLLY-VI*ILCALDFENNC*NVSKFRPFW*FSMQINIY 298 FA N IYP SI +LLY ++ +C L + +S F W S+ ++I+ Sbjct: 844 FAYINTTIYPL-TSIPLLLYCILPAICLLTGKFIIPEISNFASIWFISLFLSIF 896 >01_05_0451 - 22361617-22361811,22362728-22362842,22363443-22363513, 22363600-22363754,22363843-22363933,22364049-22364104, 22364910-22365027,22365087-22365200,22365289-22365504 Length = 376 Score = 27.1 bits (57), Expect = 7.6 Identities = 13/53 (24%), Positives = 21/53 (39%) Frame = -2 Query: 404 CCMLYKSCVP*ILKIIVKMYQNLDHFGNFQCKSIFILMNRFRLLCKQQAKLFL 246 CC + +L+++ +Y L + QCK F +C A L L Sbjct: 87 CCDFCGEPLRFVLQVVFHLYDKLQVYAPIQCKETAYHRTLFVFMCPSMACLLL 139 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,742,353 Number of Sequences: 37544 Number of extensions: 191541 Number of successful extensions: 352 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 955200320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -