BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30363 (471 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 23 1.6 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 3.8 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 5.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 6.7 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 23.0 bits (47), Expect = 1.6 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 199 LDVLTMLVFQMGRSSLMCTLYRLYRLS 119 + VLT++ F M R +C R+Y +S Sbjct: 127 VSVLTIVAFSMERYLAICHPLRVYTIS 153 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.8 bits (44), Expect = 3.8 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +1 Query: 385 DLYNIQQNTNALTKGIYYF 441 D+ NIQ+N + ++ G Y++ Sbjct: 361 DIINIQENGDQVSVGRYFY 379 Score = 20.6 bits (41), Expect = 8.8 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -2 Query: 227 EYLSSGEKRAGCADNVGFPNGSIVANVYSLSPLSF 123 E +++GE +G GS+ A+ +L+ L F Sbjct: 752 ELVTAGELFGRSGYGIGLQKGSLWADAVTLAILDF 786 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.4 bits (43), Expect = 5.0 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 398 MLYKSCVP*ILKIIVKMYQNLDHFGNFQCKSIFILMN 288 +L K +K I + Y+N G + +S F+L+N Sbjct: 50 ILVKKSTAHFVKDIYEKYKNEPMVGLYATRSPFLLLN 86 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 6.7 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -2 Query: 362 IIVKMYQNLDHFGNFQCKSIFILM 291 ++ K+Y N +C ++F+LM Sbjct: 685 VLYKIYLNTMESHEVRCTAVFLLM 708 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,685 Number of Sequences: 438 Number of extensions: 2794 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12682287 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -