BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30363 (471 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20490.1 68415.m02392 nucleolar RNA-binding Nop10p family pro... 69 2e-12 At4g32620.1 68417.m04644 expressed protein predicted protein T10... 28 3.7 >At2g20490.1 68415.m02392 nucleolar RNA-binding Nop10p family protein similar to Nop10p (GI:8096260) [Homo sapiens] Length = 64 Score = 68.5 bits (160), Expect = 2e-12 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = +1 Query: 103 MYLRYYLNDKGDREYTLATIDPFGKPTLSAHPARFSPEDKYSRHRIIIKK 252 MYL+ Y+N+KG++ YT P G T SAHPARFSP+DKYS+ R+++KK Sbjct: 1 MYLQCYINEKGEKVYTTKKESPLGLATESAHPARFSPDDKYSKQRVLLKK 50 >At4g32620.1 68417.m04644 expressed protein predicted protein T10M13.8, Arabidopsis thaliana Length = 1544 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 214 EDKYSRHRIIIKK-SLACCLHNNLNLFIKI 300 E RH +++K+ S+A C HNN+ + K+ Sbjct: 734 EQNVRRHSLLVKQVSIAECTHNNMKVLQKV 763 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,303,388 Number of Sequences: 28952 Number of extensions: 174800 Number of successful extensions: 382 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 382 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 801831960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -