BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30359 (697 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42614-1|AAC47143.1| 111|Anopheles gambiae soluble guanylate cy... 25 1.7 U42613-1|AAC47142.1| 111|Anopheles gambiae soluble guanylate cy... 25 1.7 U42612-1|AAC47141.1| 111|Anopheles gambiae soluble guanylate cy... 25 1.7 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 1.7 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 25 1.7 AF117752-1|AAD38338.1| 155|Anopheles gambiae serine protease 2A... 23 7.0 >U42614-1|AAC47143.1| 111|Anopheles gambiae soluble guanylate cyclase protein. Length = 111 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 542 LGDDCRQTAQQRPRPSITMALLLKPVIFTQKA*KWCSGLHSGD 414 L D+C A+ R ++ M + K V+ +A K G+HSG+ Sbjct: 26 LPDECENHAKCIARLALDMLDMAKNVMMGTEAMKITIGIHSGE 68 >U42613-1|AAC47142.1| 111|Anopheles gambiae soluble guanylate cyclase protein. Length = 111 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 542 LGDDCRQTAQQRPRPSITMALLLKPVIFTQKA*KWCSGLHSGD 414 L D+C A+ R ++ M + K V+ +A K G+HSG+ Sbjct: 26 LPDECENHAKCIARLALDMLDMAKNVMMGTEAMKITIGIHSGE 68 >U42612-1|AAC47141.1| 111|Anopheles gambiae soluble guanylate cyclase protein. Length = 111 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 542 LGDDCRQTAQQRPRPSITMALLLKPVIFTQKA*KWCSGLHSGD 414 L D+C A+ R ++ M + K V+ +A K G+HSG+ Sbjct: 26 LPDECENHAKCIARLALDMLDMAKNVMMGTEAMKITIGIHSGE 68 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 497 MAVVSAGPSGGSHRQGPS 550 +AVVS+ P+GG H PS Sbjct: 701 VAVVSSSPTGGHHLASPS 718 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 542 LGDDCRQTAQQRPRPSITMALLLKPVIFTQKA*KWCSGLHSGD 414 L D+C A+ R ++ M + K V+ +A K G+HSG+ Sbjct: 564 LPDECENHAKCIARLALDMLDMAKNVMMGTEAMKITIGIHSGE 606 >AF117752-1|AAD38338.1| 155|Anopheles gambiae serine protease 2A protein. Length = 155 Score = 23.4 bits (48), Expect = 7.0 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = -3 Query: 602 ARDVDLFAANQNNFVPFEKDLGDDCRQTAQQRPRPSITMALL 477 +R D+ N V +++D+G C T + PSI + ++ Sbjct: 45 SRRNDIALIELKNNVTYKQDVGPICLNTDRPEIGPSINLTVM 86 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 684,520 Number of Sequences: 2352 Number of extensions: 15105 Number of successful extensions: 34 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -