BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30358 (756 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24897| Best HMM Match : Coatomer_E (HMM E-Value=4.2e-11) 51 9e-07 SB_23022| Best HMM Match : CUB (HMM E-Value=0) 30 2.3 SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_11547| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.22) 28 7.1 >SB_24897| Best HMM Match : Coatomer_E (HMM E-Value=4.2e-11) Length = 155 Score = 51.2 bits (117), Expect = 9e-07 Identities = 32/76 (42%), Positives = 40/76 (52%), Gaps = 1/76 (1%) Frame = +3 Query: 12 DVDELFDVKNAFYVGNYQQAINEAQSVSPSTPLVALQRDAFLYRSYIAQGNYRIVQQELK 191 DVDELFDVKNAF++GNYQ INEAQ QG Y +V E+ Sbjct: 6 DVDELFDVKNAFFIGNYQGCINEAQKF---------------------QGKYSVVMDEIS 44 Query: 192 -TADPMLQPLKSLVDY 236 + P +QP++ L DY Sbjct: 45 GMSPPEVQPVRVLADY 60 >SB_23022| Best HMM Match : CUB (HMM E-Value=0) Length = 1307 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/53 (30%), Positives = 30/53 (56%) Frame = -1 Query: 315 SLDSSVPLATRASISATMADYWHQVVSNLPNSSMAVA*DLQSLVLVALSCSYP 157 S+ +SVPL+ ASIS+ + V +++P S++A +Q+ ++ S P Sbjct: 666 SIQASVPLSAVASISSVQGSDYPSVQASVPPSAVASVSSVQASDYPSIQASVP 718 >SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 29.5 bits (63), Expect = 3.1 Identities = 18/40 (45%), Positives = 23/40 (57%) Frame = +2 Query: 350 HEDNYEAALKILHNAESLELRAFTLQCLLAMNRPDLARKQ 469 H D EAAL +L S E+R TL+ L N+ DL RK+ Sbjct: 211 HVDQEEAALPMLLQRHSAEMR--TLRERLKRNKQDLIRKE 248 >SB_11547| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.22) Length = 432 Score = 28.3 bits (60), Expect = 7.1 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = +3 Query: 519 TSMAESNSGRPWYPRRTLQRDGVI*TPRFTGTWSGLSRCWGCSCQRYVGR 668 TS A S S + PR T + G I P F W S S +RY+ R Sbjct: 39 TSPALSTSLERYIPR-TFHQSGKIHHPHFPPVWQDTSSALSTSLERYIIR 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,655,868 Number of Sequences: 59808 Number of extensions: 437492 Number of successful extensions: 1048 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 944 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1048 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -