BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30358 (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 2.3 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 2.3 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 23 2.3 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 4.1 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 9.4 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.4 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 279 SISATMADYWHQVVSNLP 226 SI T+ DY+H+ NLP Sbjct: 419 SIYKTILDYYHKYKENLP 436 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 279 SISATMADYWHQVVSNLP 226 SI T+ DY+H+ NLP Sbjct: 419 SIYKTILDYYHKYKENLP 436 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 279 SISATMADYWHQVVSNLP 226 SI T+ DY+H+ NLP Sbjct: 45 SIYKTILDYYHKYKENLP 62 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 431 LLAMNRPDLARKQLKLLQDIEDD 499 +L M DL +KQLK L+D E++ Sbjct: 365 ILRMLIIDLRKKQLKSLEDWENE 387 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -2 Query: 380 FLMQLHNYLHDSKLLQPQSRI 318 + Q Y+HD+ +QPQ ++ Sbjct: 458 YTQQQFPYVHDTLQIQPQEQL 478 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 349 IVNCCSHNQEYFIGQFRTFSYSSINISNNGRLLAS 245 I+N C+ + + ++ R SY I RLL + Sbjct: 153 ILNLCAISLDRYLAVTRPVSYPQIMSPRRARLLVA 187 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,507 Number of Sequences: 438 Number of extensions: 3730 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -