BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30356 (602 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32210| Best HMM Match : Ribosomal_S14 (HMM E-Value=1.2) 28 5.1 SB_7201| Best HMM Match : ketoacyl-synt (HMM E-Value=0) 28 5.1 SB_32089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_24409| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-14) 27 8.8 >SB_32210| Best HMM Match : Ribosomal_S14 (HMM E-Value=1.2) Length = 129 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 Query: 53 KKE*NTLSIRECRGTIQEQRGFKIKQNEF*SFLLLSPNRFKTILSFRL 196 K++ L+ GT ++R K K+ + FL L +RF +L FRL Sbjct: 64 KRKRRALNFPILTGTQAQERKSKRKRTQLLDFLALMFDRFSLVLRFRL 111 >SB_7201| Best HMM Match : ketoacyl-synt (HMM E-Value=0) Length = 1821 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -3 Query: 549 SSLSTQNLKSPSVLNGEAVPVIALASQ*LLCHLN 448 SSL L S+ NG+ + AS +LCHLN Sbjct: 589 SSLIALRLAIESLENGDCEAAVVCASNIILCHLN 622 >SB_32089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 310 VYGYVYEELCN-RLAHSISPIDNDRSSVANS*PIDWHFTE 426 +YG ++LCN R HS + +D D + ++ I W +TE Sbjct: 59 LYGLT-KQLCNERPRHSTAVLDKDGNLLSKKEEIQWRWTE 97 >SB_24409| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-14) Length = 439 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 528 LKSPSVLNGEAVPVIALASQ*LLCHLNTHPARQRLRE 418 + SP ++ A VI + S+ H+N H AR+RLR+ Sbjct: 283 ISSPLLIMSAAYTVIMIRSR--ASHINGHGARERLRD 317 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,859,250 Number of Sequences: 59808 Number of extensions: 256859 Number of successful extensions: 543 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -