BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30356 (602 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748846-1|AAV28192.1| 147|Anopheles gambiae cytochrome P450 pr... 24 3.3 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 24 4.4 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 5.8 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 7.6 >AY748846-1|AAV28192.1| 147|Anopheles gambiae cytochrome P450 protein. Length = 147 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 479 SAITGTASPFSTEGDLRFWVES 544 SA TGT SP T+ D+R V++ Sbjct: 25 SATTGTGSPLLTDEDVREEVDT 46 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.8 bits (49), Expect = 4.4 Identities = 17/63 (26%), Positives = 25/63 (39%), Gaps = 3/63 (4%) Frame = -2 Query: 478 RFTIVTVSLKHPPGATKAP*NANRSVMSLQPSYGHYQSD*CC---GLTGCTTLHKRNRKR 308 RFT T PP P + S+ PSYG Q C + CT + + N + Sbjct: 365 RFTQSTAMHNQPPPPPYQPPQPYSLMASVAPSYGLPQQQNQCPIHRIQHCTCMLQNNARE 424 Query: 307 EMT 299 ++ Sbjct: 425 SIS 427 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.4 bits (48), Expect = 5.8 Identities = 18/61 (29%), Positives = 32/61 (52%) Frame = -1 Query: 527 LNRLQY*MVKQYL**RSLHNSYCVT*TPTRRDKGSVKCQSIGHEFATELRSLSIGLMLWA 348 L + Y ++K+ L + LH C+ + G+ K ++I + FA L + S G+M W+ Sbjct: 791 LRGIHYAVIKKELQDKFLHRVSCIL--KSFLSVGN-KVKAI-NTFAVALLTYSFGVMKWS 846 Query: 347 N 345 N Sbjct: 847 N 847 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 7.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 482 AITGTASPFSTEGDLRFWVESELSL 556 A+TG + PF+ + F+V LSL Sbjct: 2781 AVTGASIPFNMASSVAFFVGMGLSL 2805 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 514,040 Number of Sequences: 2352 Number of extensions: 9124 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -