BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30356 (602 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC030132-1|AAH30132.2| 812|Homo sapiens ICAM5 protein protein. 29 9.5 BC026338-1|AAH26338.1| 924|Homo sapiens intercellular adhesion ... 29 9.5 >BC030132-1|AAH30132.2| 812|Homo sapiens ICAM5 protein protein. Length = 812 Score = 29.5 bits (63), Expect = 9.5 Identities = 16/68 (23%), Positives = 28/68 (41%) Frame = -2 Query: 493 TCDSARFTIVTVSLKHPPGATKAP*NANRSVMSLQPSYGHYQSD*CCGLTGCTTLHKRNR 314 TC + + +S + PPGA ++N S +S+ + G + + C T H R Sbjct: 656 TCRAEAWPPAQISWRAPPGALNIGLSSNNSTLSVAGAMGSHGGEYECAATNAHGRHARRI 715 Query: 313 KREMTSFW 290 + W Sbjct: 716 TVRVAGPW 723 >BC026338-1|AAH26338.1| 924|Homo sapiens intercellular adhesion molecule 5, telencephalin protein. Length = 924 Score = 29.5 bits (63), Expect = 9.5 Identities = 16/68 (23%), Positives = 28/68 (41%) Frame = -2 Query: 493 TCDSARFTIVTVSLKHPPGATKAP*NANRSVMSLQPSYGHYQSD*CCGLTGCTTLHKRNR 314 TC + + +S + PPGA ++N S +S+ + G + + C T H R Sbjct: 768 TCRAEAWPPAQISWRAPPGALNIGLSSNNSTLSVAGAMGSHGGEYECAATNAHGRHARRI 827 Query: 313 KREMTSFW 290 + W Sbjct: 828 TVRVAGPW 835 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,534,005 Number of Sequences: 237096 Number of extensions: 1193864 Number of successful extensions: 1709 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1709 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6354183230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -