BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30354 (624 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 152 8e-39 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 152 8e-39 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 152 8e-39 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 32 0.017 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 1.4 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 25 2.6 U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles ... 24 4.5 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 24 4.5 EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. 24 4.5 EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. 24 4.5 EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. 24 4.5 EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. 23 6.0 EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. 23 6.0 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 23 6.0 EF519524-1|ABP73587.1| 250|Anopheles gambiae APL2 protein. 23 7.9 EF519520-1|ABP73583.1| 250|Anopheles gambiae APL2 protein. 23 7.9 EF519513-1|ABP73576.1| 250|Anopheles gambiae APL2 protein. 23 7.9 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 152 bits (369), Expect = 8e-39 Identities = 73/88 (82%), Positives = 79/88 (89%) Frame = +2 Query: 257 SAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 436 SAAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN AN Sbjct: 20 SAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLAN 79 Query: 437 VIRYFPTQALNFAFKDKYKQVFLGALTR 520 VIRYFPTQALNFAFKD YKQVFLG + + Sbjct: 80 VIRYFPTQALNFAFKDVYKQVFLGGVDK 107 Score = 56.0 bits (129), Expect = 9e-10 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 511 VDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTR 624 VDK TQFWRYF TSLCFVYPLDFARTR Sbjct: 105 VDKNTQFWRYFLGNLGSGGAAGATSLCFVYPLDFARTR 142 Score = 35.5 bits (78), Expect = 0.001 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +2 Query: 287 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 466 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 467 NFAFKDKYK 493 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 31.1 bits (67), Expect = 0.030 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 201 MSNLADPVAFAKDFLAGG 254 M+ ADP FAKDFLAGG Sbjct: 1 MTKKADPYGFAKDFLAGG 18 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 152 bits (369), Expect = 8e-39 Identities = 73/88 (82%), Positives = 79/88 (89%) Frame = +2 Query: 257 SAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 436 SAAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN AN Sbjct: 20 SAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLAN 79 Query: 437 VIRYFPTQALNFAFKDKYKQVFLGALTR 520 VIRYFPTQALNFAFKD YKQVFLG + + Sbjct: 80 VIRYFPTQALNFAFKDVYKQVFLGGVDK 107 Score = 56.0 bits (129), Expect = 9e-10 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 511 VDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTR 624 VDK TQFWRYF TSLCFVYPLDFARTR Sbjct: 105 VDKNTQFWRYFLGNLGSGGAAGATSLCFVYPLDFARTR 142 Score = 35.5 bits (78), Expect = 0.001 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +2 Query: 287 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 466 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 467 NFAFKDKYK 493 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 31.1 bits (67), Expect = 0.030 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 201 MSNLADPVAFAKDFLAGG 254 M+ ADP FAKDFLAGG Sbjct: 1 MTKKADPYGFAKDFLAGG 18 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 152 bits (369), Expect = 8e-39 Identities = 73/88 (82%), Positives = 79/88 (89%) Frame = +2 Query: 257 SAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 436 SAAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN AN Sbjct: 20 SAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLAN 79 Query: 437 VIRYFPTQALNFAFKDKYKQVFLGALTR 520 VIRYFPTQALNFAFKD YKQVFLG + + Sbjct: 80 VIRYFPTQALNFAFKDVYKQVFLGGVDK 107 Score = 56.0 bits (129), Expect = 9e-10 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +1 Query: 511 VDKKTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTR 624 VDK TQFWRYF TSLCFVYPLDFARTR Sbjct: 105 VDKNTQFWRYFLGNLGSGGAAGATSLCFVYPLDFARTR 142 Score = 36.7 bits (81), Expect = 6e-04 Identities = 22/69 (31%), Positives = 40/69 (57%) Frame = +2 Query: 287 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 466 P + V+ + +Q S + ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SGRAKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 467 NFAFKDKYK 493 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 31.1 bits (67), Expect = 0.030 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 201 MSNLADPVAFAKDFLAGG 254 M+ ADP FAKDFLAGG Sbjct: 1 MTKKADPYGFAKDFLAGG 18 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 31.9 bits (69), Expect = 0.017 Identities = 27/68 (39%), Positives = 35/68 (51%) Frame = +1 Query: 181 RSHNRTKCRTSPIRSRSLRTSWLAVLRRRLQDRRSTNRACQAAAPSTARQQADRRRPALQ 360 +S +R+K RTS RSRS RT A R + R T + AA + A + RRR + Sbjct: 444 QSRSRSKTRTS--RSRS-RTPLPARGHVRARLTRRTIPPTRVAAAAAAPEGRRRRRAIAR 500 Query: 361 GYRRRLRP 384 RRR RP Sbjct: 501 ARRRRCRP 508 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 22.6 bits (46), Expect(2) = 1.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 374 RRRYPCNAGRR 342 RRRYP NAG + Sbjct: 346 RRRYPTNAGHK 356 Score = 21.0 bits (42), Expect(2) = 1.4 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -2 Query: 431 RSYHARMKGDPAPWGCGRRRRRYP 360 R R++ P P R RRR P Sbjct: 315 REAAGRLRTGPVPGAAERHRRRRP 338 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 24.6 bits (51), Expect = 2.6 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 592 STERWLRRHHRRPDYQRSNARTASSCQR 509 + +RWLR HH + ++ SS Q+ Sbjct: 698 AVDRWLREHHLELAHAKTEMTVISSLQQ 725 >U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles gambiae putativefatty acid binding protein mRNA, partial cds. ). Length = 141 Score = 23.8 bits (49), Expect = 4.5 Identities = 12/47 (25%), Positives = 16/47 (34%) Frame = +1 Query: 211 SPIRSRSLRTSWLAVLRRRLQDRRSTNRACQAAAPSTARQQADRRRP 351 SP R+R +SW D R C +Q +RP Sbjct: 85 SPSRTRRSSSSWAMEFDEETVDGRMVKSVCTFDGNKLIHEQKGEKRP 131 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.8 bits (49), Expect = 4.5 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 250 AVLRRRLQDRRSTNRACQAAAPSTA-RQQADRRRPALQGYRRRLR 381 A RR ++RR+ A+P TA R+ A R R A RRR R Sbjct: 1117 AATARRREERRAGLPPTPPASPRTAQRRAALRERQARFRERRRNR 1161 >EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.8 bits (49), Expect = 4.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASHNKLSVVRIPPNLR 159 >EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.8 bits (49), Expect = 4.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASHNKLSVVRIPPNLR 159 >EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.8 bits (49), Expect = 4.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASHNKLSVVRIPPNLR 159 >EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASXNKLSVVRIPPNLR 159 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 23.4 bits (48), Expect = 6.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 33 EFQKRHTPTLCAPVITKLLQ 92 EFQ+R TP + +++K+ Q Sbjct: 350 EFQRRLTPAMIGELVSKMTQ 369 >EF519524-1|ABP73587.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASYNKLSVVRIPPNLR 159 >EF519520-1|ABP73583.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASYNKLSVVRIPPNLR 159 >EF519513-1|ABP73576.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 543 RW*SGLRWCRRSHLSVLRVPPRLR 614 RW L + LSV+R+PP LR Sbjct: 136 RWSFDLIDASYNKLSVVRIPPNLR 159 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,721 Number of Sequences: 2352 Number of extensions: 12453 Number of successful extensions: 52 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -